Ppif (NM_134084) Mouse Tagged ORF Clone

  • TrueORF®
SKU
MG202183
Ppif (tGFP-tagged) - Mouse peptidylprolyl isomerase F (cyclophilin F) (Ppif)
  $500.00
3 Weeks*
Specifications
Specifications
Product Data
Type Mouse Tagged ORF Clone
Target Symbol Ppif
Synonyms AW457192; CyP-D; CyP-F; CypD; PPIase
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>MG202183 representing NM_134084
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCTAGCGCTGCGTTGCGGCCCCCGCCTGCTCGGTCTGCTCTCCGGCCCGCGCTCCGCGCCGCTGCTCC
TCTCCGCGACCCGTACCTGCAGCGACGGCGGAGCCCGCGGCGCGAACTCTTCCTCCGGGAACCCGCTCGT
GTACTTGGACGTGGGCGCCGATGGACAGCCGCTCGGCCGCGTGGTGCTGGAGTTAAAGGCAGATGTCGTG
CCAAAGACTGCAGAGAACTTCAGAGCCCTATGCACTGGTGAGAAGGGCTTTGGCTACAAAGGCTCCACCT
TCCACAGGGTGATCCCAGCCTTCATGTGCCAGGCTGGCGACTTCACCAACCACAATGGCACAGGAGGGAG
GTCCATCTACGGAAGCCGCTTTCCCGACGAGAACTTCACACTGAAGCATGTGGGGCCAGGTGTCCTGTCC
ATGGCGAACGCAGGCCCCAACACCAATGGCTCTCAGTTCTTTATCTGCACGATAAAGACAGACTGGCTAG
ATGGCAAGCATGTCGTGTTCGGCCATGTCAAAGAGGGCATGGATGTTGTGAAGAAAATAGAATCTTTCGG
CTCAAAAAGTGGGAAGACGTCTAAGAAGATTGTCATCACAGACTGTGGCCAGTTGAGC


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>MG202183 representing NM_134084
Red=Cloning site Green=Tags(s)

MLALRCGPRLLGLLSGPRSAPLLLSATRTCSDGGARGANSSSGNPLVYLDVGADGQPLGRVVLELKADVV
PKTAENFRALCTGEKGFGYKGSTFHRVIPAFMCQAGDFTNHNGTGGRSIYGSRFPDENFTLKHVGPGVLS
MANAGPNTNGSQFFICTIKTDWLDGKHVVFGHVKEGMDVVKKIESFGSKSGKTSKKIVITDCGQLS

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI Cloning Scheme for this gene | Plasmid Map
ACCN NM_134084
ORF Size 618 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_134084.1, NP_598845.1
RefSeq Size 1560 bp
RefSeq ORF 621 bp
Locus ID 105675
UniProt ID Q99KR7
Cytogenetics 14 A3
Summary PPIase that catalyzes the cis-trans isomerization of proline imidic peptide bonds in oligopeptides and may therefore assist protein folding. Involved in regulation of the mitochondrial permeability transition pore (mPTP). It is proposed that its association with the mPTP is masking a binding site for inhibiting inorganic phosphate (Pi) and promotes the open probability of the mPTP leading to apoptosis or necrosis; the requirement of the PPIase activity for this function is debated. In cooperation with mitochondrial TP53 is involved in activating oxidative stress-induced necrosis. Involved in modulation of mitochondrial membrane F(1)F(0) ATP synthase activity and regulation of mitochondrial matrix adenine nucleotide levels. Has anti-apoptotic activity independently of mPTP and in cooperation with BCL2 inhibits cytochrome c-dependent apoptosis.UniProtKB/Swiss-Prot Function
Reviews
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Documents
Resources
"NM_134084" in other vectors (4)
SKU Description Size Price
MC207815 Ppif (untagged) - Mouse peptidylprolyl isomerase F (cyclophilin F) (Ppif), nuclear gene encoding mitochondrial protein, (10ug) 10 ug
$300.00
MR202183 Ppif (Myc-DDK-tagged) - Mouse peptidylprolyl isomerase F (cyclophilin F) (Ppif), nuclear gene encoding mitochondrial protein 10 ug
$289.00 $300.00
MR202183L3 Lenti ORF clone of Ppif (Myc-DDK-tagged) - Mouse peptidylprolyl isomerase F (cyclophilin F) (Ppif), nuclear gene encoding mitochondrial protein 10 ug
$600.00
MR202183L4 Lenti ORF clone of Ppif (mGFP-tagged) - Mouse peptidylprolyl isomerase F (cyclophilin F) (Ppif), nuclear gene encoding mitochondrial protein 10 ug
$600.00

Welcome to OriGene AI!

I'm your AI-powered guide to everything OriGene.
Ask me anything:

  • Product specs
  • Ordering help
  • Technical questions
  • How to find exactly what your experiment needs

Prefer a live agent? Connect with us by clicking the green chat icon, as seen in the image below or email our team at custsupport@origene.com.

Velaro Chat Img

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.