Gpx2 (NM_030677) Mouse Tagged ORF Clone

  • TrueORF®
SKU
MG201805
Gpx2 (GFP-tagged) - Mouse glutathione peroxidase 2 (Gpx2), (10ug), (Note: selenocysteine protein, Internal stop codon present. see reference data summary below)
  $318.00
3 Weeks*
Specifications
Specifications
Product Data
Type Mouse Untagged ORF Clone
Target Symbol Gpx2
Synonyms GI-G; GI-GPx; GPx-; GPx-GI; GSHPx-2; GSHPx-GI
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>MG201805 representing NM_030677
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCTTACATTGCCAAGTCGTTCTACGATCTCAGTGCCGTTGGCCTGGATGGGGAGAAGATAGACTTCA
ATACGTTCAGAGGCAGGGCTGTGCTGATTGAGAATGTGGCGTCACTCTGAGGAACAACTACCCGGGACTA
CAACCAGCTCAATGAGCTGCAATGTCGCTTTCCCAGGCGCCTGGTAGTTCTCGGCTTCCCTTGCAACCAG
TTCGGACATCAGGAGAACTGTCAGAACGAGGAGATCCTGAACAGCCTCAAGTATGTCCGACCTGGGGGTG
GGTACCAGCCCACCTTTAGTCTTACCCAAAAGTGTGACGTCAATGGGCAGAACGAGCATCCTGTCTTTGC
CTACCTGAAAGACAAGCTGCCCTACCCTTATGATGACCCGTTCTCCCTCATGACCGATCCCAAGCTCATC
ATATGGAGTCCCGTGCGCCGCTCAGACGTGTCCTGGAACTTTGAGAAGTTCCTCATAGGGCCAGAAGGGG
AGCCCTTCCGTCGCTACAGCCGCAGCTTCCAGACCATCAACATCGAGCCTGACATCAAACGGCTCCTCAA
AGTTGCCATC


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>MG201805 representing NM_030677
Red=Cloning site Green=Tags(s)

MAYIAKSFYDLSAVGLDGEKIDFNTFRGRAVLIENVASL*GTTTRDYNQLNELQCRFPRRLVVLGFPCNQ
FGHQENCQNEEILNSLKYVRPGGGYQPTFSLTQKCDVNGQNEHPVFAYLKDKLPYPYDDPFSLMTDPKLI
IWSPVRRSDVSWNFEKFLIGPEGEPFRRYSRSFQTINIEPDIKRLLKVAI

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI Cloning Scheme for this gene | Plasmid Map
ACCN NM_030677
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info The expression of this clone is not guaranteed due to the nature of selenoproteins.
OTI Annotation This clone encodes a selenoprotein containing the rare amino acid selenocysteine (Sec). Sec is encoded by UGA codon, which normally signals translational termination. Expression of this clone is not guaranteed due to the nature of selenoproteins.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_030677.2, NP_109602.2
RefSeq Size 1071 bp
RefSeq ORF 573 bp
Locus ID 14776
UniProt ID Q9JHC0
Cytogenetics 12 33.73 cM
Summary The protein encoded by this gene belongs to the glutathione peroxidase family, members of which catalyze the reduction of organic hydroperoxides and hydrogen peroxide (H2O2) by glutathione, and thereby protect cells against oxidative damage. Several isozymes of this gene family exist in vertebrates, which vary in cellular location and substrate specificity. This isozyme is predominantly expressed in the gastrointestinal tract in rodents, is localized in the cytoplasm, and whose preferred substrate is hydrogen peroxide. Knockout studies in mice lacking this gene suggest a role for this isozyme in intestinal inflammation and colon cancer development. This isozyme is also a selenoprotein, containing the rare amino acid selenocysteine (Sec) at its active site. Sec is encoded by the UGA codon, which normally signals translation termination. The 3' UTRs of selenoprotein mRNAs contain a conserved stem-loop structure, designated the Sec insertion sequence (SECIS) element, that is necessary for the recognition of UGA as a Sec codon, rather than as a stop signal. A pseudogene of this locus has been identified on chromosome 7. provided by RefSeq, Aug 2017
Reviews
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Documents
Resources
"NM_030677" in other vectors (2)
SKU Description Size Price
MC202331 Gpx2 (untagged) - Mouse glutathione peroxidase 2 (Gpx2), (10ug), (Note: selenocysteine protein, Internal stop codon present. see reference data summary below) 10 ug
$242.00
MR201805 Vimp (Myc-DDK-tagged) - Mouse histocompatibility 47 (H47), (10ug), (Note: selenocysteine protein, Internal stop codon present. see reference data summary below) 10 ug
$118.00

Welcome to OriGene AI!

I'm your AI-powered guide to everything OriGene.
Ask me anything:

  • Product specs
  • Ordering help
  • Technical questions
  • How to find exactly what your experiment needs

Prefer a live agent? Connect with us by clicking the green chat icon, as seen in the image below or email our team at custsupport@origene.com.

Velaro Chat Img

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.