OriGene Logo

Dr1 (NM_026106) Mouse Tagged ORF Clone

  • TrueORF®
Be the first to review this product
SKU
MG201545
Dr1 (tGFP-tagged) - Mouse down-regulator of transcription 1 (Dr1)
Interest in protein/lysate? Submit request here!
ORF Plasmid:
tGFP DDK
AAV Particle:
DDK
  $500.00
3 Weeks*
Bulk Requests & Clone Modifications

Frequently Bought Together (5)

TA355475 Dr1 Antibody - middle region
100 ul
$585.00
TA150041 Mouse monoclonal turboGFP antibody, clone OTI2H8
100 ul
$447.00
CC100003 DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
5 x 200 ul
$170.00
PRIMER Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
100 pmol
$59.00
PS100010 pCMV6-AC-GFP, mammalian vector with C-terminal tGFP tag, 10ug
10 ug
$780.00

Other products for "Dr1 or NM_026106"

Specifications
Specifications
Product Data
Type Mouse Tagged ORF Clone
Target Symbol Dr1
Synonyms 1700121L09Rik; Dr1l; NC2; NC2beta
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>MG201545 representing NM_026106
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCTTCCTCGTCTGGCAACGACGATGATCTCACTATCCCCAGAGCTGCTATAAATAAGATGATCAAAG
AGACTCTTCCTAATGTCCGGGTGGCCAACGATGCCCGAGAGCTGGTAGTGAACTGCTGCACGGAATTCAT
TCACCTTATATCTTCTGAAGCCAACGAGATTTGTAACAAGTCAGAAAAGAAGACAATTTCACCAGAGCAT
GTTATACAAGCACTGGAAAGTTTGGGCTTTGGCTCTTACATCAGTGAAGTAAAAGAAGTCTTACAAGAAT
GCAAGACAGTAGCATTAAAAAGAAGAAAGGCCAGTTCTCGTTTGGAAAACCTCGGCATTCCTGAAGAGGA
ATTATTGAGACAGCAACAGGAATTATTTGCAAAAGCTAGACAGCAACAAGCAGAATTGGCCCAACAGGAA
TGGCTTCAAATGCAGCAAGCAGCTCAACAAGCCCAGCTGGCTGCAGCCTCAGCCAGCGCGTCCACTCAAG
CAGGATCTTCACAAGACGAAGAAGATGATGATGACATC

ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>MG201545 representing NM_026106
Red=Cloning site Green=Tags(s)

MASSSGNDDDLTIPRAAINKMIKETLPNVRVANDARELVVNCCTEFIHLISSEANEICNKSEKKTISPEH
VIQALESLGFGSYISEVKEVLQECKTVALKRRKASSRLENLGIPEEELLRQQQELFAKARQQQAELAQQE
WLQMQQAAQQAQLAAASASASTQAGSSQDEEDDDDI

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI Cloning Scheme for this gene | Plasmid Map
ACCN NM_026106
ORF Size 528 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_026106.4, NP_080382.2
RefSeq Size 3080 bp
RefSeq ORF 531 bp
Locus ID 13486
UniProt ID Q91WV0
Cytogenetics 5 52.82 cM
Summary The association of the DR1/DRAP1 heterodimer with TBP results in a functional repression of both activated and basal transcription of class II genes. This interaction precludes the formation of a transcription-competent complex by inhibiting the association of TFIIA and/or TFIIB with TBP. Can bind to DNA on its own. Component of the ATAC complex, a complex with histone acetyltransferase activity on histones H3 and H4 (By similarity).UniProtKB/Swiss-Prot Function
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Documents
Resources
"NM_026106" in other vectors (4)
SKU Description Size Price
MC203826 Dr1 (untagged) - Mouse down-regulator of transcription 1 (Dr1), (10ug) 10 ug
$300.00
MR201545 Dr1 (Myc-DDK-tagged) - Mouse down-regulator of transcription 1 (Dr1) 10 ug
$289.00 $300.00
MR201545L3 Lenti ORF clone of Dr1 (Myc-DDK-tagged) - Mouse down-regulator of transcription 1 (Dr1) 10 ug
$600.00
MR201545L4 Lenti ORF clone of Dr1 (mGFP-tagged) - Mouse down-regulator of transcription 1 (Dr1) 10 ug
$600.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.