Atp5h (NM_027862) Mouse Tagged ORF Clone

  • TrueORF®
SKU
MG201260
Atp5h (tGFP-tagged) - Mouse ATP synthase, H+ transporting, mitochondrial F0 complex, subunit d (Atp5h)
  $350.00
3 Weeks*
Specifications
Specifications
Product Data
Type Mouse Tagged ORF Clone
Target Symbol Atp5h
Synonyms 0610009D10Rik
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>MG201260 representing NM_027862
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCTGGGCGTAAACTTGCTCTAAAAACCATTGATTGGGTATCTTTTGTGGAGGTCATGCCCCAAAACC
AGAAGGCAATTGGAAATGCCCTGAAGTCCTGGAATGAGACCTTCCACGCCAGGTTGGCTAGTCTGTCTGA
GAAACCACCTGCGATTGACTGGGCTTACTACAGGGCCAATGTGGCCAAGCCTGGCTTGGTGGATGATTTT
GAAAAGAAGTATAATGCCCTGAAGATTCCTGTGCCTGAGGATAAATACACAGCCCTGGTGGACCAGGAGG
AGAAGGAGGATGTGAAGAGCTGTGCTGAGTTTGTGTCTGGATCCCAGCTCAGGATCCAGGAGTATGAGAA
GCAGCTGGAGAAAATGAGGAACATAATTCCCTTTGACCAGATGACCATTGATGACTTGAATGAGATCTTC
CCAGAAACCAAGCTGGACAAAAAGAAGTACCCGTACTGGCCCCACCAGCCCATCGAGAACCTG


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>MG201260 representing NM_027862
Red=Cloning site Green=Tags(s)

MAGRKLALKTIDWVSFVEVMPQNQKAIGNALKSWNETFHARLASLSEKPPAIDWAYYRANVAKPGLVDDF
EKKYNALKIPVPEDKYTALVDQEEKEDVKSCAEFVSGSQLRIQEYEKQLEKMRNIIPFDQMTIDDLNEIF
PETKLDKKKYPYWPHQPIENL

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI Cloning Scheme for this gene | Plasmid Map
ACCN NM_027862
ORF Size 483 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_027862.1, NP_082138.1
RefSeq Size 574 bp
RefSeq ORF 486 bp
Locus ID 71679
UniProt ID Q9DCX2
Cytogenetics 11 E2
Summary Mitochondrial membrane ATP synthase (F(1)F(0) ATP synthase or Complex V) produces ATP from ADP in the presence of a proton gradient across the membrane which is generated by electron transport complexes of the respiratory chain. F-type ATPases consist of two structural domains, F(1) - containing the extramembraneous catalytic core, and F(0) - containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation. Part of the complex F(0) domain and the peripheric stalk, which acts as a stator to hold the catalytic alpha(3)beta(3) subcomplex and subunit a/ATP6 static relative to the rotary elements.UniProtKB/Swiss-Prot Function
Reviews
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Documents
Resources
"NM_027862" in other vectors (4)
SKU Description Size Price
MC202480 Atp5h (untagged) - Mouse ATP synthase, H+ transporting, mitochondrial F0 complex, subunit d (Atp5h), nuclear gene encoding mitochondrial protein, (10ug) 10 ug
$150.00
MR201260 Atp5h (Myc-DDK-tagged) - Mouse ATP synthase, H+ transporting, mitochondrial F0 complex, subunit d (Atp5h), nuclear gene encoding mitochondrial protein 10 ug
$289.00
MR201260L3 Lenti ORF clone of Atp5h (Myc-DDK-tagged) - Mouse ATP synthase, H+ transporting, mitochondrial F0 complex, subunit d (Atp5h), nuclear gene encoding mitochondrial protein 10 ug
$450.00
MR201260L4 Lenti ORF clone of Atp5h (mGFP-tagged) - Mouse ATP synthase, H+ transporting, mitochondrial F0 complex, subunit d (Atp5h), nuclear gene encoding mitochondrial protein 10 ug
$450.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.