OriGene Logo

Ifitm2 (NM_030694) Mouse Tagged ORF Clone

  • TrueORF®
Be the first to review this product
SKU
MG200956
Ifitm2 (tGFP-tagged) - Mouse interferon induced transmembrane protein 2 (Ifitm2)
Interest in protein/lysate? Submit request here!
ORF Plasmid:
tGFP DDK
AAV Particle:
DDK
  $350.00
3 Weeks*
Bulk Requests & Clone Modifications

Frequently Bought Together (4)

TA150041 Mouse monoclonal turboGFP antibody, clone OTI2H8
100 ul
$447.00
CC100003 DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
5 x 200 ul
$170.00
PRIMER Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
100 pmol
$59.00
PS100010 pCMV6-AC-GFP, mammalian vector with C-terminal tGFP tag, 10ug
10 ug
$780.00

Other products for "Ifitm2 or NM_030694"

Specifications
Specifications
Product Data
Type Mouse Tagged ORF Clone
Target Symbol Ifitm2
Synonyms DSPA2c; fragilis3; Ifitm3l; mil-3
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>MG200956 representing NM_030694
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGAGCCACAATTCTCAAGCCTTCTTGTCCACCAATGCCGGGCTTCCTCCAAGCTATGAGACAATCAAAG
AGGAGTACGGGGTGACTGAGCTGGGGGAACCCAGCAACTCAGCTGTTGTGAGGACCACCGTGATCAACAT
GCCCAGAGAGGTGTCGGTGCCTGACCATGTGGTCTGGTCCCTGTTCAATACACTCTTCTTCAACGCCTGC
TGCCTGGGCTTCGTTGCCTATGCCTACTCTGTGAAGTCTAGGGACAGGAAGATGGTGGGCGATGTGGTTG
GAGCCCAGGCCTACGCCTCCACTGCCAAGTGCCTGAATATCAGCTCCCTGATCTTCAGCATCCTTATGGT
CATTATCTGCATCATTATTTTCTCTACCACCTCTGTGGTAGTCTTTCAGTCTTTTGCACAAAGAACACCC
CATTCTGGATTC

ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>MG200956 representing NM_030694
Red=Cloning site Green=Tags(s)

MSHNSQAFLSTNAGLPPSYETIKEEYGVTELGEPSNSAVVRTTVINMPREVSVPDHVVWSLFNTLFFNAC
CLGFVAYAYSVKSRDRKMVGDVVGAQAYASTAKCLNISSLIFSILMVIICIIIFSTTSVVVFQSFAQRTP
HSGF

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI Cloning Scheme for this gene | Plasmid Map
ACCN NM_030694
ORF Size 432 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_030694.1, NP_109619.1
RefSeq Size 646 bp
RefSeq ORF 435 bp
Locus ID 80876
UniProt ID Q99J93
Cytogenetics 7 F5
Summary IFN-induced antiviral protein which inhibits the entry of viruses to the host cell cytoplasm, permitting endocytosis, but preventing subsequent viral fusion and release of viral contents into the cytosol. Active against multiple viruses, including influenza A virus, SARS coronavirus (SARS-CoV), Marburg virus (MARV) and Ebola virus (EBOV), Dengue virus (DNV) and West Nile virus (WNV). Can inhibit: influenza virus hemagglutinin protein-mediated viral entry, MARV and EBOV GP1,2-mediated viral entry and SARS-CoV S protein-mediated viral entry. Induces cell cycle arrest and mediates apoptosis by caspase activation and in p53-independent manner.UniProtKB/Swiss-Prot Function
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Documents
Resources
"NM_030694" in other vectors (4)
SKU Description Size Price
MC202748 Ifitm2 (untagged) - Mouse interferon induced transmembrane protein 2 (Ifitm2), (10ug) 10 ug
$150.00
MR200956 Ifitm2 (Myc-DDK-tagged) - Mouse interferon induced transmembrane protein 2 (Ifitm2) 10 ug
$289.00
MR200956L3 Lenti ORF clone of Ifitm2 (Myc-DDK-tagged) - Mouse interferon induced transmembrane protein 2 (Ifitm2) 10 ug
$450.00
MR200956L4 Lenti ORF clone of Ifitm2 (mGFP-tagged) - Mouse interferon induced transmembrane protein 2 (Ifitm2) 10 ug
$450.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.