Eif4ebp2 (NM_010124) Mouse Tagged ORF Clone

  • TrueORF®
SKU
MG200578
Eif4ebp2 (tGFP-tagged) - Mouse eukaryotic translation initiation factor 4E binding protein 2 (Eif4ebp2)
  $350.00
3 Weeks*
Specifications
Specifications
Product Data
Type Mouse Tagged ORF Clone
Target Symbol Eif4ebp2
Synonyms 4E-BP2; 2810011I19Rik; AA792569; BC010348; PHAS-II
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>MG200578 representing NM_010124
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTCCGCGTCGGCCGGTGGTAGCCACCAGCCCAGCCAGAGCCGCGCCATCCCCACGCGCACCGTGGCTA
TCAGCGACGCCGCGCAGCTACCTCAGGACTACTGCACCACGCCCGGGGGGACGCTGTTCTCCACAACGCC
GGGAGGAACACGAATCATTTATGACCGAAAGTTTCTGTTGGACCGTCGCAATTCTCCCATGGCGCAGACC
CCACCTTGCCATCTGCCCAATATCCCTGGAGTCACCAGTCCTGGCGCCTTAATTGAAGACTCCAAAGTAG
AAGTGAACAACTTAAACAACCTGAACAATCATGACAGGAAGCATGCAGTTGGGGATGAGGCTCAGTTTGA
GATGGACATC


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>MG200578 representing NM_010124
Red=Cloning site Green=Tags(s)

MSASAGGSHQPSQSRAIPTRTVAISDAAQLPQDYCTTPGGTLFSTTPGGTRIIYDRKFLLDRRNSPMAQT
PPCHLPNIPGVTSPGALIEDSKVEVNNLNNLNNHDRKHAVGDEAQFEMDI

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI Cloning Scheme for this gene | Plasmid Map
ACCN NM_010124
ORF Size 360 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_010124.2, NP_034254.1
RefSeq Size 1786 bp
RefSeq ORF 363 bp
Locus ID 13688
UniProt ID P70445
Cytogenetics 10 32.21 cM
Summary Repressor of translation initiation involved in synaptic plasticity, learning and memory formation (PubMed:16237163, PubMed:17029989). Regulates EIF4E activity by preventing its assembly into the eIF4F complex: hypophosphorylated form of EIF4EBP2 competes with EIF4G1/EIF4G3 and strongly binds to EIF4E, leading to repress translation. In contrast, hyperphosphorylated form dissociates from EIF4E, allowing interaction between EIF4G1/EIF4G3 and EIF4E, leading to initiation of translation (PubMed:17029989, PubMed:20347422, PubMed:23172145). EIF4EBP2 is enriched in brain and acts as a regulator of synapse activity and neuronal stem cell renewal via its ability to repress translation initiation (PubMed:20347422, PubMed:24139800, PubMed:23172145). Mediates the regulation of protein translation by hormones, growth factors and other stimuli that signal through the MAP kinase and mTORC1 pathways (PubMed:8939971).UniProtKB/Swiss-Prot Function
Reviews
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Documents
Resources
"NM_010124" in other vectors (4)
SKU Description Size Price
MC204270 Eif4ebp2 (untagged) - Mouse eukaryotic translation initiation factor 4E binding protein 2 (Eif4ebp2), (10ug) 10 ug
$150.00
MR200578 Eif4ebp2 (Myc-DDK-tagged) - Mouse eukaryotic translation initiation factor 4E binding protein 2 (Eif4ebp2) 10 ug
$289.00
MR200578L3 Lenti ORF clone of Eif4ebp2 (Myc-DDK-tagged) - Mouse eukaryotic translation initiation factor 4E binding protein 2 (Eif4ebp2) 10 ug
$450.00
MR200578L4 Lenti ORF clone of Eif4ebp2 (mGFP-tagged) - Mouse eukaryotic translation initiation factor 4E binding protein 2 (Eif4ebp2) 10 ug
$450.00

Welcome to OriGene AI!

I'm your AI-powered guide to everything OriGene.
Ask me anything:

  • Product specs
  • Ordering help
  • Technical questions
  • How to find exactly what your experiment needs

Prefer a live agent? Connect with us by clicking the green chat icon, as seen in the image below or email our team at custsupport@origene.com.

Velaro Chat Img

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.