OriGene Logo

Dynlt3 (NM_025975) Mouse Tagged ORF Clone

  • TrueORF®
Be the first to review this product
SKU
MG200504
Dynlt3 (tGFP-tagged) - Mouse dynein light chain Tctex-type 3 (Dynlt3)
Interest in protein/lysate? Submit request here!
ORF Plasmid:
tGFP DDK
AAV Particle:
DDK
  $350.00
3 Weeks*
Bulk Requests & Clone Modifications

Frequently Bought Together (4)

TA150041 Mouse monoclonal turboGFP antibody, clone OTI2H8
100 ul
$447.00
CC100003 DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
5 x 200 ul
$170.00
PRIMER Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
100 pmol
$59.00
PS100010 pCMV6-AC-GFP, mammalian vector with C-terminal tGFP tag, 10ug
10 ug
$780.00

Other products for "Dynlt3 or NM_025975"

Specifications
Specifications
Product Data
Type Mouse Tagged ORF Clone
Target Symbol Dynlt3
Synonyms 2310075M16Rik; AU042796; Tcte1l
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>MG200504 representing NM_025975
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGAGGGGTACCAACGGCCCTGCGATGAGGTTGGCTTCAATGCTGATGAAGCCCATAATATAGTCAAAG
AGTGTGTTGATGGAGTTTTGGGTGGTAACGATTATAATGAGAATAACATCAACCAATGGACTGCAAGCAT
AGTGGAACAGTCTATAACACATTTGGTCAAACTGGGGAAAGCTTACAAGTACATTGTGACCTGTGCAGTG
GTCCAGAGGAGCCCGTATGGATTTCACACAGCCAGCTCCTGTTTTTGGGATACAACATCTGATGGAACCT
GTACCATCAGATGGGAGAACCGTACCATGAACTGCATCGTGAATGTTTTTGCAGTTGCGATTGTCCTG

ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>MG200504 representing NM_025975
Red=Cloning site Green=Tags(s)

MEGYQRPCDEVGFNADEAHNIVKECVDGVLGGNDYNENNINQWTASIVEQSITHLVKLGKAYKYIVTCAV
VQRSPYGFHTASSCFWDTTSDGTCTIRWENRTMNCIVNVFAVAIVL

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI Cloning Scheme for this gene | Plasmid Map
ACCN NM_025975
ORF Size 348 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_025975.5
RefSeq Size 2155 bp
RefSeq ORF 351 bp
Locus ID 67117
UniProt ID P56387
Cytogenetics X A1.1
Summary Acts as one of several non-catalytic accessory components of the cytoplasmic dynein 1 complex that are thought to be involved in linking dynein to cargos and to adapter proteins that regulate dynein function. Cytoplasmic dynein 1 acts as a motor for the intracellular retrograde motility of vesicles and organelles along microtubules. Probably binds BUB3 as part of transport cargo. Required for the efficient progression through mitosis.UniProtKB/Swiss-Prot Function
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Documents
Resources
"NM_025975" in other vectors (4)
SKU Description Size Price
MC204670 Dynlt3 (untagged) - Mouse dynein light chain Tctex-type 3 (Dynlt3), (10ug) 10 ug
$150.00
MR200504 Dynlt3 (Myc-DDK-tagged) - Mouse dynein light chain Tctex-type 3 (Dynlt3) 10 ug
$289.00
MR200504L3 Lenti ORF clone of Dynlt3 (Myc-DDK-tagged) - Mouse dynein light chain Tctex-type 3 (Dynlt3) 10 ug
$450.00
MR200504L4 Lenti ORF clone of Dynlt3 (mGFP-tagged) - Mouse dynein light chain Tctex-type 3 (Dynlt3) 10 ug
$450.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.