Nrarp (NM_025980) Mouse Tagged ORF Clone

  • TrueORF®
SKU
MG200468
Nrarp (tGFP-tagged) - Mouse Notch-regulated ankyrin repeat protein (Nrarp)
  $350.00
3 Weeks*
Specifications
Specifications
Product Data
Type Mouse Tagged ORF Clone
Target Symbol Nrarp
Synonyms 2700054M22Rik
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>MG200468 representing NM_025980
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGAGCCAAGCCGAGCTGTCCACCTGCTCGGCGCCACAGACGCAGCGCATCTTCCAGGAAGCGGTGCGCA
AGGGCAACACGCAGGAGCTGCAGTCGCTGCTGCAGAACATGACTAACTGCGAATTCAACGTGAACTCGTT
CGGGCCGGAGGGCCAGACAGCACTACACCAGTCAGTCATCGACGGCAACCTGGAGCTGGTGAAGCTGTTG
GTCAAGTTCGGAGCCGACATCCGCCTAGCTAACCGCGACGGCTGGAGCGCGCTACACATCGCCGCTTTCG
GGGGCCACCAGGACATCGTGCTCTATCTCATCACCAAGGCCAAGTACGCGGCCAGCGGCCGG


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>MG200468 representing NM_025980
Red=Cloning site Green=Tags(s)

MSQAELSTCSAPQTQRIFQEAVRKGNTQELQSLLQNMTNCEFNVNSFGPEGQTALHQSVIDGNLELVKLL
VKFGADIRLANRDGWSALHIAAFGGHQDIVLYLITKAKYAASGR

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI Cloning Scheme for this gene | Plasmid Map
ACCN NM_025980
ORF Size 342 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_025980.2, NP_080256.2
RefSeq Size 2590 bp
RefSeq ORF 345 bp
Locus ID 67122
UniProt ID Q91ZA8
Cytogenetics 2 A3
Summary Downstream effector of Notch signaling. Involved in the regulation of liver cancer cells self-renewal (By similarity). Involved in the regulation of canonical Wnt signaling by stabilizing LEF1 (By similarity). Involved in angiogenesis acting downstream of Notch at branch points to regulate vascular density. Proposed to integrate endothelial Notch and Wnt signaling to control stalk cell proliferation and to stablilize new endothelial connections during angiogenesis (PubMed:19154719). During somitogenesis involved in maintenance of proper somite segmentation and proper numbers of somites and vertebrae. Required for proper anterior-posterior somite patterning. Proposed to function in a negative feedback loop to destabilize Notch 1 intracellular domain (NICD) and downregulate the Notch signal, preventing expansion of the Notch signal into the anterior somite domain (PubMed:21795391, PubMed:21998026).UniProtKB/Swiss-Prot Function
Reviews
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Documents
Resources
"NM_025980" in other vectors (4)
SKU Description Size Price
MC204870 Nrarp (untagged) - Mouse Notch-regulated ankyrin repeat protein (Nrarp), (10ug) 10 ug
$150.00
MR200468 Nrarp (Myc-DDK-tagged) - Mouse Notch-regulated ankyrin repeat protein (Nrarp) 10 ug
$289.00
MR200468L3 Lenti ORF clone of Nrarp (Myc-DDK-tagged) - Mouse Notch-regulated ankyrin repeat protein (Nrarp) 10 ug
$450.00
MR200468L4 Lenti ORF clone of Nrarp (mGFP-tagged) - Mouse Notch-regulated ankyrin repeat protein (Nrarp) 10 ug
$450.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.