OriGene Logo

Sumo1 (NM_009460) Mouse Tagged ORF Clone

  • TrueORF®
Be the first to review this product
SKU
MG200317
Sumo1 (tGFP-tagged) - Mouse SMT3 suppressor of mif two 3 homolog 1 (yeast) (Sumo1)
Interest in protein/lysate? Submit request here!
ORF Plasmid:
tGFP DDK
AAV Particle:
DDK
  $350.00
3 Weeks*
Bulk Requests & Clone Modifications

Frequently Bought Together (5)

TA355454 Sumo1 Antibody - N-terminal region
100 ul
$585.00
TA150041 Mouse monoclonal turboGFP antibody, clone OTI2H8
100 ul
$447.00
CC100003 DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
5 x 200 ul
$170.00
PRIMER Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
100 pmol
$59.00
PS100010 pCMV6-AC-GFP, mammalian vector with C-terminal tGFP tag, 10ug
10 ug
$780.00

Other products for "Sumo1 or NM_009460"

Specifications
Specifications
Product Data
Type Mouse Tagged ORF Clone
Target Symbol Sumo1
Synonyms GMP1; PIC1; SENTRIN; SMT3; Smt3C; SMT3H3; SMTP3; SUMO-1; Ubl1
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>MG200317 representing NM_009460
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTCTGACCAGGAGGCAAAACCTTCAACTGAGGACTTAGGCGATAAGAAGGAAGGAGAATACATTAAAC
TCAAAGTTATTGGACAGGATAGCAGTGAGATACATTTCAAAGTGAAAATGACAACACATCTCAAGAAACT
CAAAGAATCATACTGTCAAAGACAGGGAGTTCCAATGAATTCACTCAGGTTTCTCTTTGAAGGTCAGAGA
ATTGCTGATAATCATACTCCGAAAGAACTGGGAATGGAGGAAGAAGATGTGATTGAAGTTTATCAGGAAC
AAACGGGGGGTCACTCGACGGTT

ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>MG200317 representing NM_009460
Red=Cloning site Green=Tags(s)

MSDQEAKPSTEDLGDKKEGEYIKLKVIGQDSSEIHFKVKMTTHLKKLKESYCQRQGVPMNSLRFLFEGQR
IADNHTPKELGMEEEDVIEVYQEQTGGHSTV

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI Cloning Scheme for this gene | Plasmid Map
ACCN NM_009460
ORF Size 303 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_009460.2, NP_033486.1
RefSeq Size 1230 bp
RefSeq ORF 306 bp
Locus ID 22218
UniProt ID P63166
Cytogenetics 1 C2
Summary Ubiquitin-like protein that can be covalently attached to proteins as a monomer or a lysine-linked polymer. Covalent attachment via an isopeptide bond to its substrates requires prior activation by the E1 complex SAE1-SAE2 and linkage to the E2 enzyme UBE2I, and can be promoted by E3 ligases such as PIAS1-4, RANBP2 or CBX4. This post-translational modification on lysine residues of proteins plays a crucial role in a number of cellular processes such as nuclear transport, DNA replication and repair, mitosis and signal transduction. Involved for instance in targeting RANGAP1 to the nuclear pore complex protein RANBP2. Covalently attached to the voltage-gated potassium channel KCNB1; this modulates the gating characteristics of KCNB1. Polymeric SUMO1 chains are also susceptible to polyubiquitination which functions as a signal for proteasomal degradation of modified proteins. May also regulate a network of genes involved in palate development. Covalently attached to ZFHX3 (By similarity).UniProtKB/Swiss-Prot Function
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Documents
Resources
"NM_009460" in other vectors (4)
SKU Description Size Price
MC203534 Sumo1 (untagged) - Mouse SMT3 suppressor of mif two 3 homolog 1 (yeast) (Sumo1), (10ug) 10 ug
$150.00
MR200317 Sumo1 (Myc-DDK-tagged) - Mouse SMT3 suppressor of mif two 3 homolog 1 (yeast) (Sumo1) 10 ug
$289.00
MR200317L3 Lenti ORF clone of Sumo1 (Myc-DDK-tagged) - Mouse SMT3 suppressor of mif two 3 homolog 1 (yeast) (Sumo1) 10 ug
$450.00
MR200317L4 Lenti ORF clone of Sumo1 (mGFP-tagged) - Mouse SMT3 suppressor of mif two 3 homolog 1 (yeast) (Sumo1) 10 ug
$450.00

Welcome to OriGene AI!

I'm your AI-powered guide to everything OriGene.
Ask me anything:

  • Product specs
  • Ordering help
  • Technical questions
  • How to find exactly what your experiment needs

Prefer a live agent? Connect with us by clicking the green chat icon, as seen in the image below or email our team at custsupport@origene.com.

Velaro Chat Img

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.