Snapap (BC006744) Mouse Tagged ORF Clone

  • TrueORF®
SKU
MG200154
Snapap (tGFP-tagged) - Mouse SNAP-associated protein (cDNA clone MGC:12076 IMAGE:3708620)
  $350.00
3 Weeks*
Specifications
Specifications
Product Data
Type Mouse Tagged ORF Clone
Target Symbol Snapap
Synonyms 25kDa; AA407989; AV026596; Bloc1s7; Snap25bp; Snapap
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>MG200154 representing BC006744
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTTGGTTGCCCATTTCCTCTTCCCAGAACTGTGCCGGATCAATGAGGATCAGAAAGTGGCCCTGGATC
TGGACCCCTATGTTAAGAAGCTGCTTAATGCCAGGCGACGAGTTGTCTTGGTCAACAATATTTTACAGAA
TGCACAGGAACGACTAAGGCGGTTAAACCACAGCGTGGCCAAGGAAACAGCTCGCAGGAGAGCTATGCTG
GATTCAGGAGTTTACCCTCCTGGTTCTCCAAGCAAA


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>MG200154 representing BC006744
Red=Cloning site Green=Tags(s)

MLVAHFLFPELCRINEDQKVALDLDPYVKKLLNARRRVVLVNNILQNAQERLRRLNHSVAKETARRRAML
DSGVYPPGSPSK

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI Cloning Scheme for this gene | Plasmid Map
ACCN BC006744
ORF Size 246 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq BC006744, AAH06744
RefSeq Size 1858 bp
RefSeq ORF 248 bp
Locus ID 20615
Cytogenetics 3 F1
Summary Component of the BLOC-1 complex, a complex that is required for normal biogenesis of lysosome-related organelles (LRO), such as platelet dense granules and melanosomes. In concert with the AP-3 complex, the BLOC-1 complex is required to target membrane protein cargos into vesicles assembled at cell bodies for delivery into neurites and nerve terminals. The BLOC-1 complex, in association with SNARE proteins, is also proposed to be involved in neurite extension. Plays a role in intracellular vesicle trafficking and synaptic vesicle recycling. May modulate a step between vesicle priming, fusion and calcium-dependent neurotransmitter release through its ability to potentiate the interaction of synaptotagmin with the SNAREs and the plasma-membrane-associated protein SNAP25. Its phosphorylation state influences exocytotic protein interactions and may regulate synaptic vesicle exocytosis. May also have a role in the mechanisms of SNARE-mediated membrane fusion in non-neuronal cells (PubMed:16760431, PubMed:19546860, PubMed:21998198). As part of the BORC complex may play a role in lysosomes movement and localization at the cell periphery. Associated with the cytosolic face of lysosomes, the BORC complex may recruit ARL8B and couple lysosomes to microtubule plus-end-directed kinesin motor (By similarity).UniProtKB/Swiss-Prot Function
Reviews
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Documents
Resources
"BC006744" in other vectors (4)
SKU Description Size Price
MC200745 Snapap (untagged) - Mouse SNAP-associated protein (cDNA clone MGC:12076 IMAGE:3708620), (10ug) 10 ug
$150.00
MR200154 Snapap (Myc-DDK-tagged) - Mouse SNAP-associated protein (cDNA clone MGC:12076 IMAGE:3708620) 10 ug
$289.00
MR200154L3 Lenti ORF clone of Snapap (Myc-DDK-tagged) - Mouse SNAP-associated protein (cDNA clone MGC:12076 IMAGE:3708620) 10 ug
$450.00
MR200154L4 Lenti ORF clone of Snapap (mGFP-tagged) - Mouse SNAP-associated protein (cDNA clone MGC:12076 IMAGE:3708620) 10 ug
$450.00

Welcome to OriGene AI!

I'm your AI-powered guide to everything OriGene.
Ask me anything:

  • Product specs
  • Ordering help
  • Technical questions
  • How to find exactly what your experiment needs

Prefer a live agent? Connect with us by clicking the green chat icon, as seen in the image below or email our team at custsupport@origene.com.

Velaro Chat Img

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.