Nop10 (NM_025403) Mouse Tagged ORF Clone

  • TrueORF®
SKU
MG200048
Nop10 (tGFP-tagged) - Mouse nucleolar protein family A, member 3 (Nola3)
  $350.00
3 Weeks*
Specifications
Specifications
Product Data
Type Mouse Tagged ORF Clone
Target Symbol Nop10
Synonyms 1110036B12Rik; Nola3; NOP10P
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>MG200048 representing NM_025403
Red=Cloning site Blue=ORF Green=Tags(s)

GACGTTGTATACGACTCCTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGGCGCGCCC

ATGTTTCTCCAATATTACCTCAACGAGCAGGGCGATCGCGTTTATACGCTGAAGAAATTTGACCCTATGG
GACAACAGACTTGCTCCGCCCATCCTGCTCGGTTCTCCCCAGATGACAAATATTCAAGACACCGAATCAC
CATCAAGAAACGCTTCAAGGTGCTCATGACCCAGCAACCGCGTCCTGTCCTC


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>MG200048 representing NM_025403
Red=Cloning site Green=Tags(s)

MFLQYYLNEQGDRVYTLKKFDPMGQQTCSAHPARFSPDDKYSRHRITIKKRFKVLMTQQPRPVL

TRTRPLE - GFP Tag - V
Restriction Sites AscI-MluI Cloning Scheme for this gene | Plasmid Map
ACCN NM_025403
ORF Size 192 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_025403.4, NP_079679.1
RefSeq Size 695 bp
RefSeq ORF 195 bp
Locus ID 66181
UniProt ID Q9CQS2
Cytogenetics 2 E3
Summary Required for ribosome biogenesis and telomere maintenance. Part of the H/ACA small nucleolar ribonucleoprotein (H/ACA snoRNP) complex, which catalyzes pseudouridylation of rRNA. This involves the isomerization of uridine such that the ribose is subsequently attached to C5, instead of the normal N1. Each rRNA can contain up to 100 pseudouridine ("psi") residues, which may serve to stabilize the conformation of rRNAs. May also be required for correct processing or intranuclear trafficking of TERC, the RNA component of the telomerase reverse transcriptase (TERT) holoenzyme (By similarity).UniProtKB/Swiss-Prot Function
Reviews
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Documents
Resources
"NM_025403" in other vectors (4)
SKU Description Size Price
MC210294 Nop10 (untagged) - Mouse NOP10 ribonucleoprotein homolog (yeast) (Nop10), (10ug) 10 ug
$165.00
MR200048 Nop10 (Myc-DDK-tagged) - Mouse NOP10 ribonucleoprotein homolog (yeast) (Nop10) 10 ug
$289.00
MR200048L3 Lenti ORF clone of Nop10 (Myc-DDK-tagged) - Mouse NOP10 ribonucleoprotein homolog (yeast) (Nop10) 10 ug
$450.00
MR200048L4 Lenti ORF clone of Nop10 (mGFP-tagged) - Mouse NOP10 ribonucleoprotein homolog (yeast) (Nop10) 10 ug
$450.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.