OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

Mouse Oaz1 (BC094287) AAV Particle

  • AAV ORF®
  • Product Brand Image
Be the first to review this product
SKU
MR200056A1V
AAV ORF Particles, serotype AAV-2, Oaz1 (Myc-DDK-tagged) - Mouse ornithine decarboxylase antizyme (cDNA clone MGC:106390 IMAGE:5257966), 250ul, >10^13 GC/mL
ORF Plasmid:
tGFP DDK
Lentiviral Particles:
DDK w/ Puro mGFP w/ Puro
  $850.00
4 Weeks*

Frequently Bought Together (3)

CV900001S AAV2 with CMV promoter-driven expression of GFP, >10^13 GC/mL, 50 ul
50 ul
$427.00
CV900018L AAV2 with CMV promoter-driven expression of Myc-DDK, >10^13 GC/mL, 1 x 100 uL
1 x 100 ul
$699.00
PS100089 pAAV-AC-Myc-DDK, AAV vector with C-terminal Myc-DDK tag
10 ug
$880.00

Other products for "Oaz1 or BC094287"

Specifications
Specifications
Product Data
Tag Myc-DDK
Target Symbol Oaz1
Synonyms ODC-Az, Oaz, AZ-1, Antizyme
Vector pAAV-AC-Myc-DDK
Mammalian Cell Selection None
Sequence Data
ORF Nucleotide Sequence
>MR200056 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGTGAAATCCTCCCTGCAGCGGATCCTCAACAGCCACTGCTTCGCCAGAGAGAAGGAAGGGGACAAAC
GCAGCGCCACGCTTCACGCCAGCCGCACCATGCCGCTTCTTAGTCAGCACAGCCGCGGCGGCTGCAGCAG
CGAGAGGGTTGCCCTTAATTGCTGTAGTAACCTGGGTCCGGGGCCTCGGTGGTGCTCC

ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAGGTTTAA
Protein Sequence
>MR200056 protein sequence
Red=Cloning site Green=Tags(s)

MVKSSLQRILNSHCFAREKEGDKRSATLHASRTMPLLSQHSRGGCSSERVALNCCSNLGPGPRWCS

myc-FLAG tag
Species Mouse
Serotype AAV-2
ACCN BC094287
ORF Size 198 bp
Buffer PBS with 0.001% Pluronic F68
Stability AAV is stable for 1 year when stored at -80°C (long-term storage) or 2-3 weeks when stored at -20°C (short-term storage). Thaw the vial of AAV on ice prior to use and keep it on ice during the experiment. Thawed AAV can be stored at 4°C for 1-2 weeks. Whenever possible, particles should be aliquoted into single use portions to avoid repeated freeze/thaw cycles. Please aliquot at least 10ul per tube and use low protein binding tubes to avoid loss of virus.
Shipping Dry Ice
Reference Data
RefSeq BC094287, AAH94287
RefSeq Size 1022 bp
RefSeq ORF 200 bp
Locus ID 18245
Cytogenetics 10 39.72 cM
MW 7.2 kDa
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products