OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

GNRH2 Rabbit Polyclonal Antibody

Be the first to review this product
SKU
TA357265
GNRH2 Antibody
Size:
100 ul
Conjugation:
Unconjugated
  $585.00
5 Days*
Bulk/Customize

Frequently Bought Together (3)

TA811000S beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control 30 ul
$200.00
LY405967 Transient overexpression lysate of gonadotropin-releasing hormone 2 (GNRH2), transcript variant 3 (as WB positive control) 100 ug
$436.00
TP314336 Recombinant protein of human gonadotropin-releasing hormone 2 (GNRH2), transcript variant 1, 20 µg
20 ug
$867.00

View other "GNRH2 or NM_001501" antibodies

Specifications
Specifications
Product Data
Application IHC
Reactivity Human
Antibody Host Rabbit
Clonality Polyclonal
Immunogen The immunogen is a synthetic peptide directed towards the following sequence SDALAPLDDSMPWEGRTTAQWSLHRKRHLARTLLTAAREPRPAPPSSNKV
Specificity Expected reactivity: Human
Homology: Human: 100%
Buffer Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration lot specific
Purification Affinity Purified
Conjugation Unconjugated
Storage For short term use, store at 2-8°C up to 1 week. For long term storage, store at -20°C in small aliquots to prevent freeze-thaw cycles.
Stability Shelf life: one year from despatch.
Shipping Blue Ice
Predicted Protein Size 13 kDa
Gene Name gonadotropin releasing hormone 2
Database Link
Background The protein encoded by this gene is a preproprotein that is cleaved to form a secreted 10 aa peptide hormone. The secreted decapeptide regulates reproduction in females by stimulating the secretion of both luteinizing- and follicle-stimulating hormones. Three transcript variants that encode unique proproteins but the same peptide hormone have been found for this gene.
Synonyms GnRH-II; LH-RHII; OTTHUMP00000030076; OTTHUMP00000030077
Reference Data
Protein Categories Secreated Proteins
Protein Families Druggable Genome, Secreted Protein
Protein Pathways GnRH signaling pathway
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products