MEKK1 (MAP3K1) Rabbit Polyclonal Antibody
Specifications
| Product Data | |
| Application | WB |
|---|---|
| Recommended Dilution | WB |
| Reactivity | Human |
| Antibody Host | Rabbit |
| Isotype | IgG |
| Clonality | Polyclonal |
| Immunogen | The immunogen for anti-MAP3K1 antibody: synthetic peptide directed towards the C terminal of human MAP3K1. Synthetic peptide located within the following region: LGAFSSCYQAQDVGTGTLMAVKQVTYVRNTSSEQEEVVEALREEIRMMSH |
| Buffer | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Purification | Affinity Purified |
| Conjugation | Unconjugated |
| Storage | Store at -20°C as received. |
| Stability | Stable for 12 months from date of receipt. |
| Shipping | Blue Ice |
| Predicted Protein Size | 164 kDa |
| Gene Name | mitogen-activated protein kinase kinase kinase 1 |
| Database Link | |
| Background | The protein encoded by this gene is a serine/threonine kinase and is part of some signal transduction cascades, including the ERK and JNK kinase pathways as well as the NF-kappa-B pathway. The encoded protein is activated by autophosphorylation and requires magnesium as a cofactor in phosphorylating other proteins. This protein has E3 ligase activity conferred by a plant homeodomain (PHD) in its N-terminus and phospho-kinase activity conferred by a kinase domain in its C-terminus. provided by RefSeq, Mar 2012 |
| Synonyms | MAPKKK1; MEKK; MEKK 1; MEKK1; SRXY6 |
| Note | Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Zebrafish: 100%; Guinea pig: 100% |
| Reference Data | |
| Protein Categories | Enzyme: Kinases, Membrane Proteins |
| Protein Families | Druggable Genome, Protein Kinase |
| Protein Pathways | GnRH signaling pathway, MAPK signaling pathway, Neurotrophin signaling pathway, RIG-I-like receptor signaling pathway, Ubiquitin mediated proteolysis |
Reviews
Documents
| Product Manuals |
| FAQs |
| SDS |
Citations
The MEKK1 PHD ubiquitinates TAB1 to activate MAPKs in response to cytokines
Charlaftis, Suddason, Wu et al
EMBO J. (2014)
Charlaftis, Suddason, Wu et al
EMBO J. (2014)
Cited by 48
AI Summary: OriGene contributed pCMV6-XL4 TRAF2, pCMV6-XL4 TNIP2, and pCMV6-Myc TNIP1 plasmids used in this study to investigate the molecular mechanisms of MEKK1 PHD-mediated MAPK activation.
Snippet: … Mouse anti-TRAF2 (sc-7346), rabbit anti-STAM (sc-33588), goat anti-TAB1 (sc-6052), rabbit anti-MEKK1 (sc-252) and rabbit anti-Abin1 (or TNIP1) (sc-134660) antibodies were from Santa Cruz Biotechnology. …Rabbit anti-pItch (AB10050) antibody was purchased from Merck Millipore. …pCMV-Myc mouse MEKK1 and pCMV-Myc mouse MEKK1 C438A, I440A plasmids were purchased from GenScript. pCMV6-XL4 TRAF2, pCMV6-XL4 TNIP2 and pCMV6-Myc TNIP1 were from Origene. … Rabbit anti-pMEKK1 was custom made by ThermoScientific. Rabbit anti-phospho MEKK1 was generated as previously described (Matsuzawa et al, 2008). … Chemical inhibitors include AG-490 (EGFR inhibitor, Santa Cruz Biotechnology), NSC697923 (UBE2N inhibitor, Millipore), (5Z)-7-Oxozeaenol (TAK1 inhibitor, Sigma), SB431542 (TGFβR inhibitor, Sigma) and SB203580 (p38 MAPK inhibitor, Sigma). …
Showing 1-1 of 1 papers.
Powered by BizGenius
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.
Related Products
- Price:
- Actual Price:
Welcome to OriGene AI!
I'm your AI-powered guide to everything OriGene.
Ask me anything:
- Product specs
- Ordering help
- Technical questions
- How to find exactly what your experiment needs
Prefer a live agent? Connect with us by clicking the green chat icon, as seen in the image below or email our team at custsupport@origene.com.
