CDY1 Rabbit Polyclonal Antibody

CAT#: TA346731

Rabbit Polyclonal Anti-CDY1 Antibody

Product Images

WB Suggested Anti-CDY1 Antibody Titration: 2.5 ug/ml; Positive Control: HepG2 cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-CDY1 antibody: synthetic peptide directed towards the C terminal of human CDY1. Synthetic peptide located within the following region: FPRTWWQSAEDVHREKIQLDLEAEFYFTHLIVMFKSPRPAAMVLDRSQDF
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 62 kDa
• Gene Name: chromodomain protein, Y-linked, 1
• Database Link:
  NP_004671
  Entrez Gene 9085 Human
  UniProt ID Q9Y6F8
• Background: This gene encodes a protein containing a chromodomain and a histone acetyltransferase catalytic domain. Chromodomain proteins are components of heterochromatin-like complexes and can act as gene repressors. This protein is localized to the nucleus of late spermatids where histone hyperacetylation takes place. Histone hyperacetylation is thought to facilitate the transition in which protamines replace histones as the major DNA-packaging protein. The human chromosome Y has two identical copies of this gene within a palindromic region; this record represents the more telomeric copy. Chromosome Y also contains a pair of closely related genes in another more telomeric palindrome as well as several related pseudogenes. Two protein isoforms are encoded by transcript variants of this gene. Additional transcript variants have been described, but their full-length nature has not been determined. [provided by RefSeq, Jul 2008]
• Synonyms: CDY; CDY1A
• Note: Immunogen Sequence Homology: Human: 100%; Pig: 93%; Rat: 93%; Guinea pig: 93%; Dog: 86%; Mouse: 86%; Bovine: 86%; Horse: 85%