NAA60 Rabbit Polyclonal Antibody

SKU TA346700

Rabbit Polyclonal Anti-NAT15 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-NAT15 antibody: synthetic peptide directed towards the middle region of human NAT15. Synthetic peptide located within the following region: DYIQHLGSALASLSPCSIPHRVYRQAHSLLCSFLPWSGISSKSGIEYSRT
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.; Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 27 kDa
• Gene Name: N(alpha)-acetyltransferase 60, NatF catalytic subunit
• Database Link:
  NP_001077070
  Q9H7X0
• Background: The function of this protein remains unknown.
• Synonyms: HAT4; NAT15
• Note: Immunogen Sequence Homology: Human: 100%; Zebrafish: 100%; Rat: 93%; Rabbit: 93%; Pig: 86%; Guinea pig: 86%; Dog: 79%; Goat: 79%; Horse: 79%; Mouse: 79%; Bovine: 79%

Reference Data