Ankrd13c Rabbit Polyclonal Antibody

SKU TA346642

Rabbit Polyclonal Anti-Ankrd13c Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Mouse
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-Ankrd13c antibody is: synthetic peptide directed towards the C-terminal region of Mouse Ankrd13c. Synthetic peptide located within the following region: EQSFEPVRRQSLTPPPQNTITWEEYISAENGKAPHLGRELVCKESKKTFK
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 60 kDa
• Gene Name: ankyrin repeat domain 13c
• Database Link:
  NP_001013828
  Q3UX43
• Background: Acts as a molecular chaperone for G protein-coupled receptors, regulating their biogenesis and exit from the ER.
• Synonyms: dJ677H15.3; DKFZP566D1346; FLJ14998; RP4-677H15.5
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Zebrafish: 86%

Reference Data