DRG1 Rabbit Polyclonal Antibody

CAT#: TA346584

Rabbit Polyclonal Anti-DRG1 Antibody

Product Images

WB Suggested Anti-DRG1 Antibody Titration: 0.2-1 ug/ml; Positive Control: 721_B cell lysate.DRG1 is supported by BioGPS gene expression data to be expressed in 721_B

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-DRG1 antibody: synthetic peptide directed towards the middle region of human DRG1. Synthetic peptide located within the following region: VLKPLGHKKIIENELEGFGIRLNSKPPNIGFKKKDKGGINLTATCPQSEL
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 26 kDa
• Gene Name: developmentally regulated GTP binding protein 1
• Database Link:
  NP_004138
  Entrez Gene 4733 Human
  UniProt ID Q9Y295
• Background: Critical regulator of cell growth under specific conditions. Implicated in differentiation and cell cycle arrest.
• Synonyms: NEDD3
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Yeast: 91%; Zebrafish: 86%

Reference Data

• Protein Families: Transcription Factors