CEMIP2 Rabbit Polyclonal Antibody

SKU TA346474

Rabbit Polyclonal Anti-TMEM2 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-TMEM2 antibody: synthetic peptide directed towards the middle region of human TMEM2. Synthetic peptide located within the following region: MLTGLCQGCGTRQVVFTSDPHKSYLPVQFQSPDKAETQRGDPSVISVNGT
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 154 kDa
• Gene Name: transmembrane protein 2
• Database Link:
  NP_037522
  Q9UHN6
• Background: The function of this protein remains unknown.
• Synonyms: OTTHUMP00000021450; transmembrane protein 2
• Note: Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Human: 100%; Rabbit: 100%; Dog: 93%; Horse: 93%; Mouse: 93%; Guinea pig: 93%; Bovine: 86%

Reference Data

• Protein Families: Transmembrane