PSG9 Rabbit Polyclonal Antibody

CAT#: TA346332

Rabbit Polyclonal Anti-PSG9 Antibody

Product Images

WB Suggested Anti-PSG9 Antibody Titration: 0.2-1 ug/ml; Positive Control: HepG2 cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-PSG9 antibody: synthetic peptide directed towards the N terminal of human PSG9. Synthetic peptide located within the following region: YSNASLLIQNVTRKDAGTYTLHIIKRGDETREEIRHFTFTLYLETPKPYI
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 54 kDa
• Gene Name: pregnancy specific beta-1-glycoprotein 9
• Database Link:
  NP_002775
  Entrez Gene 5678 Human
  UniProt ID Q00887
• Background: The function remains unknown.
• Synonyms: PS34; PSBG-9; PSBG-11; PSG11; PSGII
• Note: Immunogen Sequence Homology: Human: 100%

Reference Data

• Protein Families: Secreted Protein