HSD3B1 Rabbit Polyclonal Antibody

CAT#: TA346232

Rabbit Polyclonal Anti-HSD3B1 Antibody

Product Images

WB Suggested Anti-HSD3B1 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 62500; Positive Control: Human Placenta

• 

  Host: Rabbit; Target Name: HSD3B1; Sample Tissue: Human Adult Placenta; Antibody Dilution: 1.0 ug/ml

• 

  Lanes: Lane 1: 50ug monkey brain extract; Primary Antibody Dilution: 1: 1000; Secondary Antibody: Goat anti rabbit-HRP; Secondary Antibody Dilution: 1: 10, 000; Gene Name: HSD3B1; Submitted by: Jonathan Bertin, Endoceutics Inc.

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human, Monkey
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-HSD3B1 antibody: synthetic peptide directed towards the N terminal of human HSD3B1. Synthetic peptide located within the following region: TGWSCLVTGAGGFLGQRIIRLLVKEKELKEIRVLDKAFGPELREEFSKLQ
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 42 kDa
• Gene Name: hydroxy-delta-5-steroid dehydrogenase, 3 beta- and steroid delta-isomerase 1
• Database Link:
  NP_000853
  Entrez Gene 3283 Human
  UniProt ID P14060
• Background: 3-beta-HSD is a bifunctional enzyme, that catalyzes the oxidative conversion of Delta(5)-ene-3-beta-hydroxy steroid, and the oxidative conversion of ketosteroids. The 3-beta-HSD enzymatic system plays a crucial role in the biosynthesis of all classes of hormonal steroids.
• Synonyms: 3BETAHSD; HSD3B; HSDB3; HSDB3A; I; SDR11E1
• Note: Immunogen Sequence Homology: Human: 100%; Goat: 82%; Pig: 79%; Rat: 79%; Horse: 79%; Sheep: 79%; Bovine: 79%

Reference Data

• Protein Families: Transmembrane
• Protein Pathways: Androgen and estrogen metabolism, C21-Steroid hormone metabolism, Metabolic pathways