OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

SLC26A4 Rabbit Polyclonal Antibody

Be the first to review this product
SKU
TA346192
Rabbit Polyclonal Anti-SLC26A4 Antibody
Size:
100 ul
Conjugation:
Unconjugated
  $585.00
5 Days*
Bulk/Customize

Frequently Bought Together (3)

TA811000S beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control 30 ul
$200.00
LY424715 Transient overexpression lysate of solute carrier family 26, member 4 (SLC26A4) (as WB positive control) 100 ug
$665.00
TP322532 Purified recombinant protein of Homo sapiens solute carrier family 26, member 4 (SLC26A4), 20 µg
20 ug
$867.00

View other "SLC26A4 or NM_000441" antibodies

Specifications
Specifications
Product Data
Application IHC, WB
Recommended Dilution IHC, WB
Reactivity Human
Antibody Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-SLC26A4 antibody: synthetic peptide directed towards the middle region of human SLC26A4. Synthetic peptide located within the following region: ELNDRFRHKIPVPIPIEVIVTIIATAISYGANLEKNYNAGIVKSIPRGFL
Buffer Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification Affinity Purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Shipping Blue Ice
Predicted Protein Size 86 kDa
Gene Name solute carrier family 26 member 4
Database Link
Background Mutations in this gene are associated with Pendred syndrome, the most common form of syndromic deafness, an autosomal-recessive disease. It is highly homologous to the SLC26A3 gene; they have similar genomic structures and this gene is located 3' of the SLC26A3 gene. The encoded protein has homology to sulfate transporters. provided by RefSeq, Jul 2008
Synonyms DFNB4; EVA; PDS; TDH2B
Note Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Guinea pig: 100%; Horse: 93%; Rat: 92%; Bovine: 92%
Reference Data
Protein Categories Endocrine and metabolic diseases, Membrane Proteins, Nervous system Diseases
Protein Families Druggable Genome, Transmembrane
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products