MARCO Rabbit Polyclonal Antibody

CAT#: TA346119

Rabbit Polyclonal Anti-MARCO Antibody

Product Images

WB Suggested Anti-MARCO Antibody Titration: 0.2-1 ug/ml; Positive Control: PANC1 cell lysateMARCO is supported by BioGPS gene expression data to be expressed in PANC1

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-MARCO antibody: synthetic peptide directed towards the N terminal of human MARCO. Synthetic peptide located within the following region: QARLRVLEMYFLNDTLAAEDSPSFSLLQSAHPGEHLAQGASRLQVLQAQL
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 53 kDa
• Gene Name: macrophage receptor with collagenous structure
• Database Link:
  NP_006761
  Entrez Gene 8685 Human
  UniProt ID Q9UEW3
• Background: The protein encoded by this gene is a member of the class A scavenger receptor family and is part of the innate antimicrobial immune system. The protein may bind both Gram-negative and Gram-positive bacteria via an extracellular, C-terminal, scavenger receptor cysteine-rich (SRCR) domain. In addition to short cytoplasmic and transmembrane domains, there is an extracellular spacer domain and a long, extracellular collagenous domain. The protein may form a trimeric molecule by the association of the collagenous domains of three identical polypeptide chains.
• Synonyms: SCARA2
• Note: Immunogen Sequence Homology: Human: 100%

Reference Data

• Protein Families: Druggable Genome, Transmembrane