WDR5 Rabbit Polyclonal Antibody

CAT#: TA345998

Rabbit Polyclonal Anti-WDR5 Antibody

Product Images

WB Suggested Anti-WDR5 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 62500; Positive Control: 721_B cell lysate

• 

  Sample Type: Human brain stem cells (NT2) Primary Antibody Dilution: 1: 500; Secondary Antibody: Goat anti-rabbit Alexa Fluor 594; Secondary Antibody: ilution: 1: 1000; Color/Signal Descriptions: Red: WDR5 Blue: DAPI; Gene Name: WDR5; Submitted by: Dr. Yuzhi Chen, University of Arkansas for Medical Science

• 

  Amount and Sample Type: 500 ug Human NT2 cell lysate; Amount of IP Antibody: 6 ug; Primary Antibody: WDR5; Primary Antibody Dilution: 1: 500; Secondary Antibody: Goat anti-rabbit Alexa-Fluor 594; Secondary Antibody Dilution: 1: 5000; Gene Name: WDR5; Submitted by: Dr. Yuzhi Chen, University of Arkansas for Medical Science

Specifications

Product Data

• Applications: IHC, IP, WB
• Recommended Dilution: IHC, WB, IP
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-WDR5 antibody: synthetic peptide directed towards the C terminal of human WDR5. Synthetic peptide located within the following region: LAGHTKAVSSVKFSPNGEWLASSSADKLIKIWGAYDGKFEKTISGHKLGI
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 36 kDa
• Gene Name: WD repeat domain 5
• Database Link:
  NP_060058
  Entrez Gene 11091 Human
  UniProt ID P61964
• Background: This gene encodes a member of the WD repeat protein family. WD repeats are minimally conserved regions of approximately 40 amino acids typically bracketed by gly-his and trp-asp (GH-WD), which may facilitate formation of heterotrimeric or multiprotein complexes. Members of this family are involved in a variety of cellular processes, including cell cycle progression, signal transduction, apoptosis, and gene regulation. This protein contains 7 WD repeats. Alternatively spliced transcript variants encoding the same protein have been identified.
• Synonyms: BIG-3; CFAP89; SWD3
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Guinea pig: 100%; Zebrafish: 93%; Yeast: 91%

Reference Data

• Protein Families: Druggable Genome