Igf2bp3 Rabbit Polyclonal Antibody
Specifications
| Product Data | |
| Application | WB |
|---|---|
| Recommended Dilution | WB |
| Reactivity | Mouse |
| Antibody Host | Rabbit |
| Isotype | IgG |
| Clonality | Polyclonal |
| Immunogen | The immunogen for anti-Igf2bp3 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: QQNPSPQLRGRRGPGQRGSSRQASPGSVSKQKPCDLPLRLLVPTQFVGAI |
| Buffer | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Purification | Affinity Purified |
| Conjugation | Unconjugated |
| Storage | Store at -20°C as received. |
| Stability | Stable for 12 months from date of receipt. |
| Shipping | Blue Ice |
| Predicted Protein Size | 63 kDa |
| Gene Name | insulin-like growth factor 2 mRNA binding protein 3 |
| Database Link | |
| Background | Igf2bp3 is a RNA-binding protein that act as a regulator of mRNA translation and stability. Igf2bp3 binds to the 5'-UTR of the insulin-like growth factor 2 (IGF2) mRNAs. Igf2bp3 binds to sequences in the 3' UTR of CD44 mRNA. |
| Synonyms | CT98; DKFZp686F1078; hKOC; IMP-3; IMP3; KOC1; VICKZ3 |
| Note | Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Human: 100%; Bovine: 100%; Guinea pig: 100%; Rat: 93%; Horse: 93%; Mouse: 93%; Rabbit: 93%; Yeast: 85% |
| Reference Data | |
| Protein Categories | Cytokines, Growth Factors, Intracellular Proteins |
Reviews
Documents
| Product Manuals |
| FAQs |
| SDS |
Citations
Prognostic value of insulin-like growth factor 2 mRNA-binding protein 3 and vascular endothelial growth factor-A in patients with primary non-small-cell lung cancer
Liu, Liu, Gong et al
Oncol Lett (2019) 18 (5), 4744-4752 DOI: 10.3892/ol.2019.10835
Liu, Liu, Gong et al
Oncol Lett (2019) 18 (5), 4744-4752 DOI: 10.3892/ol.2019.10835
AI Summary: OriGene products, specifically the monoclonal mouse anti-human CD34 antibody (cat. no. TA320263) and the anti-IGF2BP3 rabbit polyclonal antibody (cat. no. TA322483), were used for immunohistochemical detection of CD34 and IMP3 expression in NSCLC tissue samples, contributing to the study’s analysis of tumor angiogenesis and prognosis.
Snippet: Main reagents The main reagents were as follows: Monoclonal mouse anti-human CD34 antibody (1:100;cat. … TA320263;OriGene Technologies, Inc.);anti-IGF2BP3 rabbit polyclonal antibody (1:200;cat. … TA322483;anti-VEGF-A rabbit monoclonal antibody (1:100;cat. …
Showing 1-1 of 1 papers.
Powered by BizGenius
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.
Related Products
- Price:
- Actual Price:
Welcome to OriGene AI!
I'm your AI-powered guide to everything OriGene.
Ask me anything:
- Product specs
- Ordering help
- Technical questions
- How to find exactly what your experiment needs
Prefer a live agent? Connect with us by clicking the green chat icon, as seen in the image below or email our team at custsupport@origene.com.
