OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

hnRNP Q (SYNCRIP) Rabbit Polyclonal Antibody

Be the first to review this product
SKU
TA345956
Rabbit Polyclonal Anti-SYNCRIP Antibody
Size:
100 ul
Conjugation:
Unconjugated
  $525.00
5 Days*
Bulk/Customize

Frequently Bought Together (3)

TA811000S beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control 30 ul
$200.00
LY416691 Transient overexpression lysate of synaptotagmin binding, cytoplasmic RNA interacting protein (SYNCRIP), transcript variant 1 (as WB positive control) 100 ug
$665.00
TP317902 Purified recombinant protein of Human synaptotagmin binding, cytoplasmic RNA interacting protein (SYNCRIP), transcript variant 1, full length, with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20 µg
20 ug
$737.00

View other "hnRNP Q or NM_006372" antibodies

Specifications
Specifications
Product Data
Application WB
Recommended Dilution WB
Reactivity Human
Antibody Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-SYNCRIP antibody: synthetic peptide directed towards the N terminal of human SYNCRIP. Synthetic peptide located within the following region: MATEHVNGNGTEEPMDTTSAVIHSENFQTLLDAGLPQKVAEKLDEIYVAG
Buffer Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Purification Protein A purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Shipping Blue Ice
Predicted Protein Size 69 kDa
Gene Name synaptotagmin binding cytoplasmic RNA interacting protein
Database Link
Background Heterogenous nuclear ribonucleoprotein (hnRNP) implicated in mRNA processing mechanisms. SYNCRIP may be involved in translationally coupled mRNA turnover. It implicated with other RNA-binding proteins in the cytoplasmic deadenylation/translational and decay interplay of the FOS mRNA mediated by the major coding-region determinant of instability (mCRD) domain. It interacts in vitro preferentially with poly(A) and poly(U) RNA sequences.
Synonyms GRY-RBP; GRYRBP; hnRNP-Q; HNRNPQ; HNRPQ1; NSAP1; PP68
Note Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%
Reference Data
Protein Categories Intracellular Proteins
Protein Families Stem cell - Pluripotency
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products