hnRNP Q (SYNCRIP) (NM_006372) Human Recombinant Protein

SKU
TP317902
Purified recombinant protein of Human synaptotagmin binding, cytoplasmic RNA interacting protein (SYNCRIP), transcript variant 1, full length, with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$737.00
In Stock*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC217902 representing NM_006372
Red=Cloning site Green=Tags(s)

MATEHVNGNGTEEPMDTTSAVIHSENFQTLLDAGLPQKVAEKLDEIYVAGLVAHSDLDERAIEALKEFNE
DGALAVLQQFKDSDLSHVQNKSAFLCGVMKTYRQREKQGTKVADSSKGPDEAKIKALLERTGYTLDVTTG
QRKYGGPPPDSVYSGQQPSVGTEIFVGKIPRDLFEDELVPLFEKAGPIWDLRLMMDPLTGLNRGYAFVTF
CTKEAAQEAVKLYNNHEIRSGKHIGVCISVANNRLFVGSIPKSKTKEQILEEFSKVTEGLTDVILYHQPD
DKKKNRGFCFLEYEDHKTAAQARRRLMSGKVKVWGNVGTVEWADPIEDPDPEVMAKVKVLFVRNLANTVT
EEILEKAFSQFGKLERVKKLKDYAFIHFDERDGAVKAMEEMNGKDLEGENIEIVFAKPPDQKRKERKAQR
QAAKNQMYDDYYYYGPPHMPPPTRGRGRGGRGGYGYPPDYYGYEDYYDYYGYDYHNYRGGYEDPYYGYED
FQVGARGRGGRGARGAAPSRGRGAAPPRGRAGYSQRGGPGSARGVRGARGGAQQQRGRGVRGARGGRGGN
VGGKRKADGYNQPDSKRRQTNNQNWGSQPIAQQPLQGGDHSGNYGYKSENQEFYQDTFGQQWK

SGPTRTRRLEQKLISEEDLAANDILDYKDDDDKV
Tag Myc-DDK
Predicted MW 69.4 kDa
Concentration >0.05 µg/µL as determined by microplate Bradford method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_006363
Locus ID 10492
UniProt ID O60506
Cytogenetics 6q14.3
RefSeq Size 2932
RefSeq ORF 1869
Synonyms GRY-RBP; GRYRBP; hnRNP-Q; HNRNPQ; HNRPQ1; NSAP1; PP68
Summary This gene encodes a member of the cellular heterogeneous nuclear ribonucleoprotein (hnRNP) family. hnRNPs are RNA binding proteins that complex with heterogeneous nuclear RNA (hnRNA) and regulate alternative splicing, polyadenylation, and other aspects of mRNA metabolism and transport. The encoded protein plays a role in multiple aspects of mRNA maturation and is associated with several multiprotein complexes including the apoB RNA editing-complex and survival of motor neurons (SMN) complex. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene, and a pseudogene of this gene is located on the short arm of chromosome 20. [provided by RefSeq, Dec 2011]
Protein Families Stem cell - Pluripotency
Write Your Own Review
You're reviewing:hnRNP Q (SYNCRIP) (NM_006372) Human Recombinant Protein
Your Rating
SKU Description Size Price
LC416691 SYNCRIP HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC431415 SYNCRIP HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC431483 SYNCRIP HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC431486 SYNCRIP HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC431504 SYNCRIP HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY416691 Transient overexpression lysate of synaptotagmin binding, cytoplasmic RNA interacting protein (SYNCRIP), transcript variant 1 100 ug
$665.00
LY431415 Transient overexpression lysate of synaptotagmin binding, cytoplasmic RNA interacting protein (SYNCRIP), transcript variant 2 100 ug
$436.00
LY431483 Transient overexpression lysate of synaptotagmin binding, cytoplasmic RNA interacting protein (SYNCRIP), transcript variant 5 100 ug
$436.00
LY431486 Transient overexpression lysate of synaptotagmin binding, cytoplasmic RNA interacting protein (SYNCRIP), transcript variant 6 100 ug
$436.00
LY431504 Transient overexpression lysate of synaptotagmin binding, cytoplasmic RNA interacting protein (SYNCRIP), transcript variant 4 100 ug
$436.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.