EIF3S4 (EIF3G) Rabbit Polyclonal Antibody

SKU TA345852

Rabbit Polyclonal Anti-EIF3G Antibody

Product Data

• Application: IHC, IP, WB
• Recommended Dilution: WB, IHC, IP
• Reactivity: Human, Mouse
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-EIF3G antibody: synthetic peptide directed towards the middle region of human EIF3G. Synthetic peptide located within the following region: LRDGASRRGESMQPNRRADDNATIRVTNLSEDTRETDLQELFRPFGSISR
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 35 kDa
• Gene Name: eukaryotic translation initiation factor 3 subunit G
• Database Link:
  NP_003746
  O75821
• Background: EIF3G belongs to the eIF-3 subunit G family. It is a component of the eukaryotic translation initiation factor 3 (eIF-3) complex, which is required for several steps in the initiation of protein synthesis.
• Synonyms: eIF3-delta; EIF3-P42; eIF3-p44; EIF3S4
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Zebrafish: 100%; Guinea pig: 100%; Goat: 86%

Reference Data