CIRBP Rabbit Polyclonal Antibody
USD 436.00
USD 200.00
USD 867.00
Specifications
Product Data | |
Applications | WB |
Recommended Dilution | WB |
Reactivities | Human |
Host | Rabbit |
Isotype | IgG |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-CIRBP antibody: synthetic peptide directed towards the N terminal of human CIRBP. Synthetic peptide located within the following region: MASDEGKLFVGGLSFDTNEQSLEQVFSKYGQISEVVVVKDRETQRSRGFG |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage | Store at -20°C as received. |
Stability | Stable for 12 months from date of receipt. |
Predicted Protein Size | 19 kDa |
Gene Name | cold inducible RNA binding protein |
Database Link | |
Background | CIRBP contains 1 RRM (RNA recognition motif) domain. It seems to play an essential role in cold-induced suppression of cell proliferation. |
Synonyms | CIRP |
Note | Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Human: 100%; Bovine: 100%; Mouse: 93%; Guinea pig: 93%; Zebrafish: 79% |
Reference Data |
Documents
Product Manuals |
FAQs |
SDS |
{0} Product Review(s)
Be the first one to submit a review