PRMT8 Rabbit Polyclonal Antibody

SKU TA345679

Rabbit Polyclonal Anti-PRMT8 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-PRMT8 antibody: synthetic peptide directed towards the C terminal of human PRMT8. Synthetic peptide located within the following region: YLEDYLTVRRGEEIYGTISMKPNAKNVRDLDFTVDLDFKGQLCETSVSND
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 43 kDa
• Gene Name: protein arginine methyltransferase 8
• Database Link:
  NP_062828
  Q9NR22
• Background: PRMT8 probably methylates the guanidino nitrogens of arginyl residues in some proteins.
• Synonyms: HRMT1L3; HRMT1L4
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Zebrafish: 92%

Reference Data

• Protein Families: Druggable Genome