SIDT2 Rabbit Polyclonal Antibody

CAT#: TA345644

Rabbit Polyclonal Anti-SIDT2 Antibody

Product Images

WB Suggested Anti-SIDT2 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 1562500; Positive Control: Hela cell lysate

• 

  Host: Rabbit; Target Name: NOP56; Sample Tissue: Human Fetal Brain; Antibody Dilution: 1.0 ug/ml

• 

  Host: Rabbit; Target Name: SERPINA3; Sample Tissue: Human Adult Placenta; Antibody Dilution: 1.0 ug/ml

• 

  Host: Rabbit; Target Name: EGFL8; Sample Tissue: HepG2; Antibody Dilution: 1.0 ug/ml.SIDT2 is strongly supported by BioGPS gene expression data to be expressed in Human HepG2 cells

• 

  Host: Rabbit; Target Name: WT1; Sample Tissue: 721_B; Antibody Dilution: 1.0 ug/ml.SIDT2 is supported by BioGPS gene expression data to be expressed in 721_B

Show all 5 images

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-SIDT2 antibody: synthetic peptide directed towards the N terminal of human SIDT2. Synthetic peptide located within the following region: LNKQKGAPLLFVVRQKEAVVSFQVPLILRGMFQRKYLYQKVERTLCQPPT
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 94 kDa
• Gene Name: SID1 transmembrane family member 2
• Database Link:
  NP_001035545
  Entrez Gene 51092 Human
  UniProt ID Q8NBJ9
• Background: SIDT2 belongs to the SID1 family. It is a multi-pass membrane protein. The exact function of SIDT2 remains unknown.
• Synonyms: CGI-40
• Note: Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Human: 100%; Bovine: 100%; Guinea pig: 100%; Dog: 93%; Horse: 93%; Mouse: 93%; Rabbit: 93%

Reference Data

• Protein Families: Transmembrane