KLF17 Rabbit Polyclonal Antibody

CAT#: TA345593

Rabbit Polyclonal Anti-KLF17 Antibody

Product Images

WB Suggested Anti-KLF17 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 62500; Positive Control: HepG2 cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-KLF17 antibody: synthetic peptide directed towards the N terminal of human KLF17. Synthetic peptide located within the following region: YGRPQAEMEQEAGELSRWQAAHQAAQDNENSAPILNMSSSSGSSGVHTSW
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 42 kDa
• Gene Name: Kruppel-like factor 17
• Database Link:
  NP_775755
  Entrez Gene 128209 Human
  UniProt ID Q5JT82
• Background: KLF17 binds G/C-rich sites via its zinc fingers and activates transcription from CACCC-box elements. It may be a germ cell-specific transcription factor that plays important roles in spermatid differentiation and oocyte development.
• Synonyms: Zfp393; ZNF393
• Note: Immunogen Sequence Homology: Human: 100%; Rat: 82%