ZNF554 Rabbit Polyclonal Antibody

SKU TA345534

Rabbit Polyclonal Anti-ZNF554 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-ZNF554 antibody: synthetic peptide directed towards the N terminal of human ZNF554. Synthetic peptide located within the following region: GYLPRWSQELVTFEDVSMDFSQEEWELLEPAQKNLYREVMLENYRNVVSL
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 60 kDa
• Gene Name: zinc finger protein 554
• Database Link:
  NP_001096121
  Q86TJ5
• Background: ZNF554 is a new candidate transcription factor.
• Synonyms: FLJ34817
• Note: Immunogen Sequence Homology: Rat: 100%; Horse: 100%; Human: 100%; Bovine: 100%; Dog: 93%; Pig: 93%

Reference Data

• Protein Families: Transcription Factors