Dmbx1 Rabbit Polyclonal Antibody

SKU TA345533

Rabbit Polyclonal Anti-Dmbx1 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Mouse
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-Dmbx1 antibody is: synthetic peptide directed towards the C-terminal region of Mouse Dmbx1. Synthetic peptide located within the following region: SLSAAAAAHQGVWGSPLLPAPPTGLAPASAALNSKTTSIENLRLRAKQHA
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 41 kDa
• Gene Name: diencephalon/mesencephalon homeobox 1
• Database Link:
  NP_570935
  Q91ZK4
• Background: Dmbx1 functions as a transcriptional repressor. It may repress OTX2-mediated transactivation by forming a heterodimer with OTX2 on the P3C (5'-TAATCCGATTA-3') sequence and is required for brain development, neonatal survival, postnatal growth, and nursing ability.
• Synonyms: MBX; OTX3; PAXB
• Note: Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Zebrafish: 100%; Guinea pig: 100%; Dog: 93%

Reference Data