Grhl2 Rabbit Polyclonal Antibody
Specifications
| Product Data | |
| Application | WB |
|---|---|
| Recommended Dilution | WB |
| Reactivity | Rat |
| Antibody Host | Rabbit |
| Isotype | IgG |
| Clonality | Polyclonal |
| Immunogen | The immunogen for Anti-Grhl2 antibody is: synthetic peptide directed towards the N-terminal region of Rat Grhl2. Synthetic peptide located within the following region: MPSDPPFNTRRAYTSEDEAWKSYLENPLTAATKAMMSINGDEDSAAALGL |
| Buffer | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Purification | Affinity Purified |
| Conjugation | Unconjugated |
| Storage | Store at -20°C as received. |
| Stability | Stable for 12 months from date of receipt. |
| Shipping | Blue Ice |
| Predicted Protein Size | 68 kDa |
| Gene Name | grainyhead-like transcription factor 2 |
| Database Link | |
| Background | The function of this protein remains unknown. |
| Synonyms | 0610015A08Rik; BOM; RGD1561191; Tcfcp2l3 |
| Note | Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Zebrafish: 92% |
| Reference Data | |
Reviews
Documents
| Product Manuals |
| FAQs |
| SDS |
Citations
Overexpression of grainyhead-like transcription factor 2 is associated with poor prognosis in human pancreatic carcinoma
Wang, Pan, Zhang et al
Oncol Lett (2019) 17 (2), 1491-1496 DOI: 10.3892/ol.2018.9741
Wang, Pan, Zhang et al
Oncol Lett (2019) 17 (2), 1491-1496 DOI: 10.3892/ol.2018.9741
AI Summary: OriGene’s mouse monoclonal anti-β-actin antibody (cat. no. TA811000) was used as a loading control in western blot experiments to assess GRHL2 protein expression in pancreatic carcinoma cell lines.
Snippet: … The membranes were blocked with 5% non-fat milk in TBS/Tween-20 for 2 h at room temperature and blotted with primary antibodies of rabbit monoclonal anti-GRHL2 (cat. …TA811000;1:400;OriGene Technologies, Inc., Beijing, China) overnight at 4°C
Showing 1-1 of 1 papers.
Powered by BizGenius
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.
Related Products
- Price:
- Actual Price:
Welcome to OriGene AI!
I'm your AI-powered guide to everything OriGene.
Ask me anything:
- Product specs
- Ordering help
- Technical questions
- How to find exactly what your experiment needs
Prefer a live agent? Connect with us by clicking the green chat icon, as seen in the image below or email our team at custsupport@origene.com.
