BBX Rabbit Polyclonal Antibody

SKU TA345283

Rabbit Polyclonal Anti-BBX Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-BBX antibody: synthetic peptide directed towards the middle region of human BBX. Synthetic peptide located within the following region: VSAFFSLAALAEVAAMENVHRGQRSTPLTHDGQPKEMPQAPVLISCADQ
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 101 kDa
• Gene Name: bobby sox homolog (Drosophila)
• Database Link:
  NP_064620
  Q8WY36
• Background: BBX is a transcription factor that is necessary for cell cycle progression from G1 to S phase.
• Synonyms: ARTC1; HBP2; HSPC339; MDS001
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%

Reference Data

• Protein Families: Transcription Factors