OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

CUTC Rabbit Polyclonal Antibody

Be the first to review this product
SKU
TA345086
Rabbit Polyclonal Anti-CUTC Antibody - middle region
Size:
100 ul
Conjugation:
Unconjugated
  $585.00
5 Days*
Bulk/Customize

Frequently Bought Together (3)

TA811000S beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control 30 ul
$200.00
LY414278 Transient overexpression lysate of cutC copper transporter homolog (E. coli) (CUTC) (as WB positive control) 100 ug
$436.00
TP305748 Recombinant protein of human cutC copper transporter homolog (E. coli) (CUTC), 20 µg
20 ug
$867.00

View other "CUTC or NM_015960" antibodies

Specifications
Specifications
Product Data
Application WB
Recommended Dilution WB
Reactivity Human
Antibody Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-CUTC antibody: synthetic peptide directed towards the middle region of human CUTC. Synthetic peptide located within the following region: LEGLPLIKRLIEQAKGRIVVMPGGGITDRNLQRILEGSGATEFHCSARST
Buffer Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification Affinity Purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Shipping Blue Ice
Predicted Protein Size 29 kDa
Gene Name cutC copper transporter
Database Link
Background Members of the CUT family of copper transporters are associated with copper homeostasis and are involved in the uptake, storage, delivery, and efflux of copper (Gupta et al., 1995 PubMed 7635807; Li et al., 2005 PubMed 16182249). supplied by OMIM, Mar 2008. ##Evidence-Data-START## Transcript exon combination :: BC028948.1, AF132966.1 ECO:0000332 RNAseq introns :: single sample supports all introns ERS025081, ERS025082 ECO:0000348 ##Evidence-Data-END##
Synonyms CGI-32
Note Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Zebrafish: 86%
Reference Data
Protein Categories Intracellular Proteins
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products