YTHDF1 Rabbit Polyclonal Antibody

SKU TA344965

Rabbit Polyclonal Anti-YTHDF1 Antibody - middle region

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-YTHDF1 antibody: synthetic peptide directed towards the middle region of human YTHDF1. Synthetic peptide located within the following region: QQAPSPQAAPQPQQVAQPLPAQPPALAQPQYQSPQQPPQTRWVAPRNRNA
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.; Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 61 kDa
• Gene Name: YTH N6-methyladenosine RNA binding protein 1
• Database Link:
  NP_060268
  Q9BYJ9
• Background: The function of this protein remains unknown.
• Synonyms: C20orf21
• Note: Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Guinea pig: 100%; Dog: 93%; Mouse: 86%; Rabbit: 85%; Yeast: 83%

Reference Data