CCDC87 Rabbit Polyclonal Antibody

CAT#: TA344903

Reviews ()
Write a review

Rabbit Polyclonal Anti-CCDC87 Antibody - C-terminal region



USD 360.00


Availability*
5 Days

Size
    • 100 ul


Product images

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivity Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-CCDC87 antibody: synthetic peptide directed towards the C terminal of human CCDC87. Synthetic peptide located within the following region: ALLARLEWFEGQASNPNRFFKKTNLSSSHFLEENQVRSHLHRKLNLMESS
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Purification Affinity Purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 96 kDa
Gene Name coiled-coil domain containing 87
Background The function of this protein remains unknown.
Synonyms FLJ10786
Note Immunogen Sequence Homology: Human: 100%; Pig: 85%; Horse: 79%
Reference Data
Other products for "CCDC87"
Frequently bought together (3)
Recombinant protein of human coiled-coil domain containing 87 (CCDC87)
    • 20 ug

USD 748.00


Transient overexpression lysate of coiled-coil domain containing 87 (CCDC87)
    • 100 ug

USD 360.00


beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

USD 169.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Antibody Performance Guarantee banner
ANTIBODY VALIDATION 101
Clone ID reveals the Source of Monoclonal Antibodies