RNPEPL1 Rabbit Polyclonal Antibody

SKU TA344900

Rabbit Polyclonal Anti-RNPEPL1 Antibody - N-terminal region

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-RNPEPL1 antibody: synthetic peptide directed towards the N terminal of human RNPEPL1. Synthetic peptide located within the following region: LKPADIGPRSRVWAEPCLLPTATSKLSGAVEQWLSAAERLYGPYMWGRYD
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 55 kDa
• Gene Name: arginyl aminopeptidase (aminopeptidase B)-like 1
• Database Link:
  NP_060696
  Q9HAU8
• Background: The function of this protein remains unknown.
• Synonyms: FLJ10806; FLJ26675; MGC99544
• Note: Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Dog: 93%; Guinea pig: 93%

Reference Data

• Protein Families: Druggable Genome