OGDHL Rabbit Polyclonal Antibody

CAT#: TA344893

Rabbit Polyclonal Anti-OGDHL Antibody - N-terminal region

Product Images

WB Suggested Anti-OGDHL Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:1562500; Positive Control: COLO205 cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-OGDHL antibody: synthetic peptide directed towards the N terminal of human OGDHL. Synthetic peptide located within the following region: VFGWRSRSSGPPATFPSSKGGGGSSYMEEMYFAWLENPQSVHKSWDSFFR
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 114 kDa
• Gene Name: oxoglutarate dehydrogenase-like
• Database Link:
  NP_060715
  Entrez Gene 55753 Human
  UniProt ID Q9ULD0
• Background: The function of OGDHL remains unknown.
• Synonyms: FLJ10851
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Human: 100%; Horse: 92%; Rat: 85%; Bovine: 85%

Reference Data

• Protein Pathways: Citrate cycle (TCA cycle), Lysine degradation, Metabolic pathways, Tryptophan metabolism