PCID2 Rabbit Polyclonal Antibody

CAT#: TA344864

Rabbit Polyclonal Anti-RGD1307041 Antibody - middle region

Product Images

WB Suggested Anti-RGD1307041 Antibody; Titration: 1.0 ug/ml; Positive Control: Rat Heart

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Rat
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-RGD1307041 antibody: synthetic peptide corresponding to a region of Rat. Synthetic peptide located within the following region: MLFLVNQLFKIYFKINKLHLCKPLIRAIDSSNLKDDYSTAQRVTYKYYVG
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 42 kDa
• Gene Name: PCI domain containing 2
• Database Link:
  NP_060856
  Entrez Gene 55795 Human
  UniProt ID Q5JVF3
• Background: The function remains unknown.
• Synonyms: F10
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Horse: 93%; Zebrafish: 79%