CoCoA (CALCOCO1) Rabbit Polyclonal Antibody

CAT#: TA344754

Reviews ()
Write a review

Rabbit Polyclonal Anti-CALCOCO1 Antibody



USD 539.00


Availability*
5 Days

Size
    • 100 ul


Product images

Other products for "CALCOCO1"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-CALCOCO1 antibody: synthetic peptide directed towards the N terminal of human CALCOCO1. Synthetic peptide located within the following region: ESTTDGSPIHTSVQFQASYLPKPGAQLYQFRYVNRQGQVCGQSPPFQFRE
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Purification Affinity Purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 77 kDa
Gene Name calcium binding and coiled-coil domain 1
Background CALCOCO1 functions as a coactivator for aryl hydrocarbon and nuclear receptors (NR).CALCOCO1 is recruited to promoters through its contact with the N-terminal basic helix-loop-helix-Per-Arnt-Sim (PAS) domain of transcription factors or coactivators, such as NCOA2. During ER-activation CALCOCO1 acts synergistically in combination with other NCOA2-binding proteins, such as EP300, CREBBP and CARM1. CALCOCO1 is involved in the transcriptional activation of target genes in the Wnt/CTNNB1 pathway. CALCOCO1 functions as a secondary coactivator in LEF1-mediated transcriptional activation via its interaction with CTNNB1. Coactivator function for nuclear receptors and LEF1/CTNNB1 involves differential utilization of two different activation regions.
Synonyms calphoglin; Cocoa; PP13275
Note Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%
Reference Data
Protein Families Transcription Factors
Frequently bought together (3)
Recombinant protein of human calcium binding and coiled-coil domain 1 (CALCOCO1), transcript variant 1
    • 100 ug

USD 2,950.00


Transient overexpression lysate of calcium binding and coiled-coil domain 1 (CALCOCO1), transcript variant 1
    • 100 ug

USD 436.00


beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

USD 200.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.