TRAPPC1 Rabbit Polyclonal Antibody

SKU TA344728

Rabbit Polyclonal Anti-TRAPPC1 Antibody - middle region

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-TRAPPC1 antibody: synthetic peptide directed towards the middle region of human TRAPPC1. Synthetic peptide located within the following region: YKLMYGMLFSIRSFVSKMSPLDMKDGFLAFQTSRYKLHYYETPTGIKVVM
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 17 kDa
• Gene Name: trafficking protein particle complex 1
• Database Link:
  NP_067033
  Q9Y5R8
• Background: This gene product plays a role in vesicular transport of proteins to the Golgi apparatus from the endoplasmic reticulum. The encoded protein is a component of the multisubunit transport protein particle (TRAPP) complex. Alternative splicing results in multiple transcript variants.
• Synonyms: BET5; MUM2
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Yeast: 100%; Bovine: 100%; Rabbit: 100%; Zebrafish: 100%; Guinea pig: 100%

Reference Data