E2 230K (UBE2O) Rabbit Polyclonal Antibody

SKU TA344708

Rabbit Polyclonal Anti-UBE2O Antibody - middle region

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-UBE2O antibody: synthetic peptide directed towards the middle region of human UBE2O. Synthetic peptide located within the following region: YNEAGFDSDRGLQEGYENSRCYNEMALIRVVQSMTQLVRRPPEVFEQEIR
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.; Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 141 kDa
• Gene Name: ubiquitin conjugating enzyme E2 O
• Database Link:
  NP_071349
  Q9C0C9
• Background: UBE2O catalyzes the covalent attachment of ubiquitin to other proteins.
• Synonyms: E2-230K
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%

Reference Data

• Protein Pathways: Ubiquitin mediated proteolysis