BBS1 Rabbit Polyclonal Antibody

SKU TA344665

Rabbit Polyclonal Anti-BBS1 Antibody - N-terminal region

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Mouse
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-Bbs1 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: PCVYVYKNLRPYFKFSLPQLPPNPLEQDVWNQAKEDQIDPLTLKEMLEDI
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 65 kDa
• Gene Name: Bardet-Biedl syndrome 1
• Database Link:
  NP_078925
  Q8NFJ9
• Background: The function of this protein remains unknown.
• Synonyms: BBS2L2
• Note: Immunogen Sequence Homology: Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Dog: 93%; Pig: 93%; Bovine: 86%; Guinea pig: 86%

Reference Data