Glutaredoxin 2 (GLRX2) Rabbit Polyclonal Antibody
Specifications
| Product Data | |
| Application | WB |
|---|---|
| Recommended Dilution | WB |
| Reactivity | Human |
| Antibody Host | Rabbit |
| Isotype | IgG |
| Clonality | Polyclonal |
| Immunogen | The immunogen for anti-GLRX2 antibody: synthetic peptide directed towards the middle region of human GLRX2. Synthetic peptide located within the following region: NVNYKVVELDLLEYGNQFQDALYKMTGERTVPRIFVNGTFIGGATDTHRLH |
| Buffer | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
| Purification | Affinity Purified |
| Conjugation | Unconjugated |
| Storage | Store at -20°C as received. |
| Stability | Stable for 12 months from date of receipt. |
| Shipping | Blue Ice |
| Predicted Protein Size | 18 kDa |
| Gene Name | glutaredoxin 2 |
| Database Link | |
| Background | GLRX2 is a glutathione-dependent oxidoreductase that facilitates the maintenance of mitochondrial redox homeostasis upon induction of apoptosis by oxidative stress.GLRX2 is involved in response to hydrogen peroxide and regulation of apoptosis caused by oxidative stress.GLRX2 acts as a very efficient catalyst of monothiol reactions because of its high affinity for protein glutathione-mixed disulfides.GLRX2 can receive electrons not only from glutathione (GSH), but also from thioredoxin reductase supporting both monothiol and dithiol reactions.GLRX2 efficiently catalyzes both glutathionylation and deglutathionylation of mitochondrial complex I, which in turn regulates the superoxide production by the complex. Overexpression of GLRX2 decreases the susceptibility to apoptosis and prevents loss of cardiolipin and cytochrome c release. |
| Synonyms | CGI-133; GRX2 |
| Note | Immunogen Sequence Homology: Human: 100%; Mouse: 93%; Dog: 86%; Pig: 86%; Rat: 86%; Horse: 86%; Sheep: 86%; Bovine: 86%; Rabbit: 86%; Guinea pig: 86% |
| Reference Data | |
| Protein Categories | Intracellular Proteins |
| Protein Families | Transcription Factors |
Reviews
Documents
| Product Manuals |
| FAQs |
| SDS |
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.
Related Products
- Price:
- Actual Price:
Welcome to OriGene AI!
I'm your AI-powered guide to everything OriGene.
Ask me anything:
- Product specs
- Ordering help
- Technical questions
- How to find exactly what your experiment needs
Prefer a live agent? Connect with us by clicking the green chat icon, as seen in the image below or email our team at custsupport@origene.com.
