TRIM49 Rabbit Polyclonal Antibody

CAT#: TA344474

Rabbit Polyclonal Anti-TRIM49 Antibody - middle region

Product Images

WB Suggested Anti-TRIM49 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:312500; Positive Control: 293T cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-TRIM49 antibody: synthetic peptide directed towards the middle region of human TRIM49. Synthetic peptide located within the following region: VHITLHHEEANNDIFLYEILRSMCIGCDHQDVPYFTATPRSFLAWGVQTF
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 53
• Gene Name: tripartite motif containing 49
• Database Link:
  NP_065091
  Entrez Gene 57093 Human
  UniProt ID P0CI25
• Background: TRIM49 contains a RING zinc finger, a motif known to be involved in protein-protein interactions. This protein has been found to be preferentially expressed in testis.
• Synonyms: RNF18; TRIM49A; TRIM49L2
• Note: Immunogen Sequence Homology: Human: 100%

Reference Data

• Protein Families: Druggable Genome