SNAP47 Rabbit Polyclonal Antibody
Specifications
| Product Data | |
| Application | IHC, WB |
|---|---|
| Recommended Dilution | WB, IHC |
| Reactivity | Human, Mouse |
| Antibody Host | Rabbit |
| Isotype | IgG |
| Clonality | Polyclonal |
| Immunogen | The immunogen for anti-CAT antibody: synthetic peptide directed towards the middle region of human CAT. Synthetic peptide located within the following region: LKDAQIFIQKKAVKNFTEVHPDYGSHIQALLDKYNAEKPKNAIHTFVQSG |
| Buffer | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Purification | Affinity Purified |
| Conjugation | Unconjugated |
| Storage | Store at -20°C as received. |
| Stability | Stable for 12 months from date of receipt. |
| Shipping | Blue Ice |
| Predicted Protein Size | 58 kDa |
| Gene Name | synaptosome associated protein 47kDa |
| Database Link | |
| Background | This gene encodes catalase, a key antioxidant enzyme in the bodies defense against oxidative stress. Catalase is a heme enzyme that is present in the peroxisome of nearly all aerobic cells. Catalase converts the reactive oxygen species hydrogen peroxide t |
| Synonyms | C1orf142; ESFI5812; HEL-S-290; HEL170; SNAP-47; SVAP1 |
| Note | Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 93%; Goat: 93%; Sheep: 93%; Bovine: 93%; Guinea pig: 86% |
| Reference Data | |
| Protein Categories | Intracellular Proteins, Membrane Proteins |
| Protein Pathways | SNARE interactions in vesicular transport |
Reviews
Documents
| Product Manuals |
| FAQs |
| SDS |
Citations
VAMP5 and distinct sets of cognate Q-SNAREs mediate exosome release
Matsui, Sakamaki, Hiragi et al
Cell Struct Funct (2023)
Matsui, Sakamaki, Hiragi et al
Cell Struct Funct (2023)
Cited by 21
Showing 1-1 of 1 papers.
Powered by BizGenius
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.
Related Products
- Price:
- Actual Price:
Welcome to OriGene AI!
I'm your AI-powered guide to everything OriGene.
Ask me anything:
- Product specs
- Ordering help
- Technical questions
- How to find exactly what your experiment needs
Prefer a live agent? Connect with us by clicking the green chat icon, as seen in the image below or email our team at custsupport@origene.com.
