ESD Rabbit Polyclonal Antibody

SKU TA344262

Rabbit Polyclonal Anti-ESD Antibody - N-terminal region

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-ESD antibody: synthetic peptide directed towards the N terminal of human ESD. Synthetic peptide located within the following region: MALKQISSNKCFGGLQKVFEHDSVELNCKMKFAVYLPPKAETGKCPALYW
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 31 kDa
• Gene Name: esterase D
• Database Link:
  NP_001975
  P10768
• Background: ESD is a serine hydrolase involved in the detoxification of formaldehyde.
• Synonyms: FGH
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Horse: 100%; Human: 100%; Bovine: 100%; Rat: 92%; Mouse: 92%; Rabbit: 92%; Guinea pig: 92%; Zebrafish: 91%

Reference Data